Recombinant Anthoceros formosae Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Anthoceros formosae (Hornwort)
Target Names
ycf4
Target Protein Sequence
MNWESEWFRIELIRGSRRISNFFWAFILLSGALGFLSVGLSSYFGKDLISFLSYEQIVFI PQGIVMCFYGIAGSAFSLYLWGTIFWNIGSGYNKFDKGKGIVCIYRWGFPGKNRRIRIEF SMKDIEAIGMEVQEGFYPRRTLRLKIKGQQDVPLTYIGENLTLREIEEEAAELARFLQIS IEGF
Uniprot No.

Target Background

Function
Plays a crucial role in the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How has the ycf4 gene evolved across different plant lineages, and what does this reveal about chloroplast genome evolution?

The ycf4 gene shows remarkable evolutionary patterns across plant lineages, particularly in legumes:

  • Hypermutation: In some legumes, especially Lathyrus species, ycf4 is located in a mutation hotspot with a mutation rate at least 20 times higher than the rest of the chloroplast genome .

  • Divergence: The Ycf4 protein sequence has diverged more within the single genus Lathyrus than between cyanobacteria and other angiosperms, indicating extreme accelerated evolution .

  • Gene Loss: The ycf4 gene has been lost from the chloroplast genome in Lathyrus odoratus and separately in three other legume groups .

  • Size Expansion: In soybean and Lotus japonicus, the Ycf4 protein has expanded to about 200 residues compared to the typical 184-185 amino acids in most plants .

Comparative analysis between Lathyrus latifolius and L. cirrhosus reveals:

  • Only 1 nucleotide substitution in rbcL genes

  • Only 3 substitutions in atpB-rbcL intergenic spacer

  • 56 differences in 1023-bp-long ycf4 (dS = 0.048, dN = 0.039)

  • 19 differences (10% divergence) in the spacer between accD and ycf4

This localized hypermutation violates the common assumption that point mutation rates are approximately constant across a genome and may contribute to gene loss or relocation to the nucleus.

  • What is the function of Ycf4 in photosystem I assembly and how does its role differ across photosynthetic organisms?

The Ycf4 protein plays a crucial role in photosystem I (PSI) assembly, but its importance varies across different photosynthetic organisms:

OrganismRole of Ycf4Phenotype of ycf4 Mutants
Chlamydomonas reinhardtiiEssential for PSI assemblyComplete loss of PSI activity; autotrophic growth failure
Synechocystis sp. PCC 6803Involved in PSI assemblyIncreased PSII-to-PSI ratio but still able to assemble PSI
Tobacco (Nicotiana tabacum)Mixed reports on essentialitySome studies report autotrophic growth in knockout mutants; others report no autotrophic growth

In Chlamydomonas, Ycf4 functions as a scaffold protein during the assembly process, specifically:

  • It stabilizes an intermediate subcomplex consisting of the PsaAB heterodimer and the three stromal subunits PsaCDE

  • It facilitates the addition of the PsaF subunit to this subcomplex

In addition to PSI assembly, Ycf4 has been found as a protein component of the eyespot in Chlamydomonas chloroplasts, suggesting a potential secondary function .

Research approaches to study Ycf4 function include:

  • Creation of knockout mutants through chloroplast transformation

  • Protein-protein interaction studies using co-immunoprecipitation

  • Pulse-chase protein labeling to track assembly intermediates

  • Electron microscopy of purified complexes

  • What is known about the Ycf4-containing complex structure and its interactions with other proteins?

The Ycf4 protein has been found in a large complex in Chlamydomonas reinhardtii. Key characteristics of this complex include:

  • Size: The complex is >1500 kD, with the largest structures measuring 285 × 185 Å .

  • Composition: The complex contains:

    • Ycf4

    • COP2 (an opsin-related protein)

    • PSI subunits: PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF

  • Association: Almost all Ycf4 and COP2 in wild-type cells copurify by sucrose gradient ultracentrifugation and ion exchange column chromatography, indicating their intimate and exclusive association .

  • Assembly role: Pulse-chase protein labeling revealed that the PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex .

Methodological approaches for studying this complex include:

  • Tandem affinity purification using tagged Ycf4

  • Mass spectrometry (liquid chromatography-tandem mass spectrometry) for protein identification

  • Immunoblotting for specific component verification

  • Electron microscopy for structural characterization

  • Sucrose gradient ultracentrifugation for complex isolation

  • Ion exchange chromatography for purification

  • How does RNA editing affect the expression and function of the ycf4 gene in Anthoceros formosae?

RNA editing is a post-transcriptional modification process that changes the nucleotide sequence of RNA from that of the corresponding DNA. In Anthoceros formosae, RNA editing plays a significant role in chloroplast gene expression:

  • Extent of RNA editing: In total, 507 C→U and 432 U→C conversions have been identified in the transcripts of 68 genes and eight ORFs in A. formosae chloroplasts .

  • Functional implications:

    • Unusual initiation codons (ACG) are converted to the standard AUG start codon through C→U RNA editing in several genes

    • 164 nonsense codons (UGA, UAA, UAG) in 52 protein-coding genes and seven ORFs are converted to sense codons (CGA, CAA, CAG) by U→C conversion

While the search results don't specifically mention RNA editing in the ycf4 transcript of A. formosae, the extensive RNA editing in this organism suggests it likely affects ycf4 expression as well.

To study RNA editing in ycf4, researchers should:

  • Compare genomic DNA and cDNA sequences

  • Use high-throughput sequencing to identify all editing sites

  • Perform functional studies with edited vs. non-edited constructs

  • Investigate RNA editing factors that might specifically target ycf4

  • What regulatory compliance requirements apply to research with recombinant Anthoceros formosae Ycf4?

Research involving recombinant Ycf4 protein must comply with the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. Key compliance requirements include:

  • Definition of recombinant DNA: The NIH Guidelines define recombinant nucleic acids as:

    • Molecules constructed by joining nucleic acid molecules that can replicate in a living cell

    • Nucleic acid molecules that are chemically or otherwise synthesized or amplified

    • Molecules that result from the replication of those described above

  • Institutional requirements:

    • Institutional Biosafety Committee (IBC) approval is required for many experiments

    • The level of review depends on the experiment classification (III-A through III-F)

    • Compliance is mandatory for institutions receiving NIH funding for research involving recombinant or synthetic nucleic acid molecules

  • Experiment classification:

    ClassificationDescriptionRequired Approvals
    III-ADeliberate transfer of drug resistance traits to microorganisms not known to acquire them naturallyIBC, RAC review, NIH Director approval
    III-BCloning of toxin molecules with LD50 < 100 ng/kg body weightIBC, NIH/OSP approval
    III-CHuman gene transferIBC, IRB, RAC review
    III-DVarious experiments with different risk levelsIBC approval before initiation
    III-ELower risk experimentsIBC notice simultaneous with initiation
    III-FExempt experimentsNone required
  • Updated requirements: As of April 2024, the NIH has updated guidelines for research involving gene drive modified organisms (GDMOs) , though these are less relevant to work with Ycf4 specifically.

Researchers must ensure proper training, report any significant problems or violations, and adhere to IBC-approved emergency plans for handling accidental spills and personnel contamination .

  • How can researchers reconcile contradictory findings about the essentiality of Ycf4 across different species?

Different studies have reported contradictory findings regarding the essentiality of Ycf4 for PSI assembly and photosynthesis in various organisms. To reconcile these findings, researchers should consider:

  • Experimental design differences:

    • The extent of gene knockout (complete vs. partial)

    • One study noted that a previous tobacco ycf4 knockout removed only 93 of 184 amino acids from the N-terminus, whereas their study removed the complete sequence

    • Growth conditions (light intensity, carbon source availability)

  • Evolutionary context:

    • The importance of Ycf4 appears to have decreased during evolution from green algae to land plants

    • Cyanobacteria (Synechocystis) can assemble PSI without Ycf4, albeit at reduced levels

    • Chlamydomonas absolutely requires Ycf4 for PSI assembly

    • Higher plants show intermediate phenotypes

  • Potential redundancy:

    • Higher plants may have evolved redundant mechanisms for PSI assembly

    • Nuclear-encoded factors might compensate for the loss of chloroplast-encoded Ycf4

    • Alternative assembly pathways might exist in some species but not others

  • Methodological approaches to resolve contradictions:

    • Generate complete knockouts using precise genome editing techniques

    • Conduct complementation experiments with Ycf4 from different species

    • Perform detailed biochemical analysis of PSI assembly intermediates

    • Use standardized growth conditions across experiments

    • Measure PSI accumulation and function using multiple methods (spectroscopy, protein analysis, electron transport measurements)

    • Investigate potential compensatory mechanisms through transcriptomics and proteomics

  • What technical challenges exist in structural studies of Ycf4 and how can they be addressed?

Structural studies of membrane proteins like Ycf4 present several challenges:

  • Expression challenges:

    • Membrane protein overexpression often leads to toxicity in host cells

    • Improper folding can result in inclusion body formation

    • Low yields compared to soluble proteins

  • Purification difficulties:

    • Detergent selection is critical for maintaining protein stability and native conformation

    • Detergent micelles can interfere with crystallization

    • Protein-detergent complexes are heterogeneous

  • Structural analysis limitations:

    • X-ray crystallography is challenging due to difficulty in obtaining well-diffracting crystals

    • NMR is limited by protein size and requires isotopic labeling

    • Cryo-EM has resolution limitations for smaller membrane proteins

Methodological solutions:

ChallengeSolution Approaches
Expression- Use specialized E. coli strains (C41, C43, Lemo21)
- Test multiple expression systems (yeast, insect cells)
- Optimize codon usage
- Use fusion partners to improve solubility (SUMO, MBP)
- Regulate expression level through promoter strength
Purification- Screen multiple detergents (DDM, LMNG, GDN)
- Use styrene-maleic acid lipid particles (SMALPs)
- Apply amphipols for detergent replacement
- Use nanodiscs to reconstitute in lipid bilayer
Structural Analysis- Combine multiple techniques (X-ray, NMR, cryo-EM)
- Use lipidic cubic phase for crystallization
- Apply single-particle cryo-EM analysis
- Use cross-linking mass spectrometry to identify interaction interfaces
- Implement integrative modeling using low-resolution data

Recent advances in cryo-EM have revolutionized membrane protein structural biology. The Ycf4-containing complex from Chlamydomonas has been visualized by electron microscopy , and similar approaches could be applied to the A. formosae protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.