Recombinant Anthoceros formosae Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is produced via heterologous expression in E. coli and purified using affinity chromatography . Key specifications include:

  • Purity: >90% (SDS-PAGE)

  • Form: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

  • Reconstitution: Requires sterile water (0.1–1.0 mg/mL) and glycerol (5–50%) for long-term storage .

Storage at -20°C/-80°C is recommended to avoid degradation, with aliquoting to prevent freeze-thaw cycles .

Role in Photosystem II Assembly

CP47 stabilizes the PSII reaction center and facilitates the attachment of the CP43 subunit during assembly . Cryo-EM studies reveal that recombinant CP47 interacts with assembly factors like Psb27 and Psb28 to form intermediate complexes .

Chloride Binding and Oxygen Evolution

Mutations in CP47 (e.g., R448S) disrupt chloride binding, impairing oxygen evolution. Under chloride-limiting conditions:

  • Oxygen recovery slows significantly (t1/2 = 308 s vs. 50 s in wild type) .

  • Altered S-state lifetimes suggest CP47’s role in stabilizing the Mn4CaO5 cluster .

RNA Metabolism and Regulation

The psbB gene cluster requires intricate RNA processing, including splicing and stabilization by factors like HCF107 and Mbb1 . These processes ensure efficient translation of CP47 and adjacent PSII subunits .

Applications in Research

  • Antibody Production: Polyclonal antibodies against CP47 (e.g., Agrisera AS04 038) enable Western blot and native PAGE analyses .

  • Structural Studies: Used in cryo-EM to resolve PSII assembly intermediates .

  • Functional Assays: Evaluates chloride dependence and photoinhibition in PSII mutants .

  • ELISA Kits: Commercial kits (e.g., Anagnostics CSB-CF772863ALI) quantify CP47 expression .

Technical Challenges and Solutions

  • Instability: Lyophilization with trehalose preserves activity during storage .

  • Low Yield: Codon optimization and E. coli strain selection improve expression .

Key Research Findings

StudyKey Result
CP47-Cl⁻ Interaction (Wu et al., 2001)R448S mutation disrupts chloride binding, delaying O2 recovery .
Cryo-EM of PSII Assembly (2021)CP47-Psb34 interaction stabilizes RC47-CP43 intermediates .
RNA Processing (PMC3555233, 2012)HCF107 stabilizes psbH transcripts, indirectly affecting CP47 synthesis .

Future Directions

  • Engineering Thermostable Variants: For industrial photosynthetic applications.

  • Mechanistic Studies: Resolving how CP47 cooperates with PsbJ/Psb28 during assembly .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Anthoceros formosae (Hornwort)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLIAVHLMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITKSWGGWSITGETVTNAGIWSYEGVAAVHIVLSGLLFLAAIWHWVYWDL ELFRDERTGKPSLDLPKIFGIHLFLSGVLCFGFGAFHVTGLFGPGIWVSDPYGLTGKVEP VAPAWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKGLRMGNVETVLSS SIAAVFFAAFVVAGTMWYGSAATPIELFGPTRYQWDQGFFQQEIDRRIRSSKAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHAVFKDKEGHELFVRRMP TFFETFPVVLVDEEGIVRADIPFRRAESKYSVEQVGVIVEFYGGELDGVSFSDPVTVKKY ARRAQLGEIFEFDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDSDLDAQVEFGAFEKLGDPTTKRQVV
Uniprot No.

Target Background

Function
CP47, also known as Photosystem II CP47 chlorophyll apoprotein (psbB), is a crucial component of the Photosystem II (PSII) core complex. It binds chlorophyll and plays a vital role in catalyzing the primary light-induced photochemical reactions within PSII. PSII, a light-driven water:plastoquinone oxidoreductase, utilizes light energy to extract electrons from water, producing oxygen and a proton gradient that subsequently drives ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of the CP47 chlorophyll apoprotein in Anthoceros formosae?

CP47 (PsbB) serves as a core antenna chlorophyll binding subunit of Photosystem II. This protein plays a critical role in light harvesting and energy transfer to the reaction center. In the structural organization of PSII, CP47 is recruited to form the PSII core complex only after D1 has successfully assembled with D2, facilitating the further binding of oxygen-evolving enhancer (OEE) proteins . The protein contains multiple transmembrane domains that coordinate chlorophyll molecules, positioning them to efficiently capture and transfer light energy to the reaction center.

Within the chloroplast genome of hornworts like Anthoceros formosae, the psbB gene is part of a conserved transcription unit found across land plants. This organization reflects the evolutionary conservation of this essential photosynthetic component from early land plants through to vascular plants .

How does the psbB gene organize within the chloroplast genome of Anthoceros formosae?

The psbB gene in Anthoceros formosae is located within a conserved operon structure in the chloroplast genome. The complete chloroplast genome sequence of Anthoceros formosae has provided valuable insights into early land plant evolution . Within this genome, the psbB exists as part of a transcription unit that, in vascular plants, is typically pentacistronic - encoding not only CP47 but also other critical photosynthetic components.

The organization includes:

  • The psbB gene encoding CP47

  • Adjacent genes encoding other PSII subunits (psbT, psbH)

  • Genes encoding cytochrome b6f complex components (petB, petD)

This gene arrangement is highly conserved across land plants, suggesting the fundamental importance of coordinated expression of these photosynthetic components .

What expression systems are commonly used for producing recombinant CP47 protein?

The production of recombinant CP47 protein typically employs bacterial expression systems, with E. coli being the predominant host. Based on similar recombinant photosystem proteins, the methodology involves:

  • Gene cloning: The psbB coding sequence is PCR-amplified from Anthoceros formosae genomic DNA or cDNA

  • Vector construction: The sequence is inserted into an expression vector containing:

    • An inducible promoter (often T7 or similar)

    • A fusion tag (commonly His-tag) for purification

    • Appropriate selection markers

  • Transformation and expression: The recombinant vector is transformed into an E. coli expression strain (BL21(DE3) or derivatives) with expression typically induced using IPTG .

The expressed protein is then purified using affinity chromatography, taking advantage of the His-tag or other fusion tags. Due to the membrane-associated nature of CP47, specialized solubilization and purification protocols may be necessary to maintain protein integrity.

How do post-transcriptional modifications affect psbB expression in Anthoceros formosae?

The expression of the psbB gene in hornworts involves complex post-transcriptional processing mechanisms that are critical for proper protein production. RNA editing, a characteristic feature in hornwort chloroplasts, plays a significant role in psbB expression . This process involves the conversion of specific cytidines to uridines in the RNA transcript, potentially altering the coding sequence and the resulting protein structure.

Intercistronic processing represents another crucial modification step. The psbB gene exists within a polycistronic transcription unit, requiring precise processing to generate functional monocistronic mRNAs. This involves:

  • Endonucleolytic cleavage at specific sites

  • Protection of processed transcripts by RNA-binding proteins

  • Stabilization of cleaved transcripts to prevent degradation

These post-transcriptional events require numerous specificity factors that have evolved to confer stability to the processed RNA transcripts, exemplifying the complexity of chloroplast RNA metabolism. Researchers working with recombinant expressions must consider these modifications when designing constructs and experimental approaches.

What are the methodological challenges in expressing functional recombinant CP47 protein?

Expression of functional recombinant CP47 presents several significant challenges:

  • Membrane protein solubilization: As an integral membrane protein, CP47 contains multiple transmembrane domains that make it inherently hydrophobic and difficult to solubilize while maintaining native structure.

  • Chlorophyll incorporation: The native protein binds multiple chlorophyll molecules critical for function. Recombinant systems typically lack the chlorophyll biosynthesis machinery, necessitating in vitro reconstitution approaches.

  • Protein folding issues: The complex folding requirements often lead to inclusion body formation in bacterial systems, requiring careful refolding protocols.

  • Assembly constraints: In native systems, CP47 assembles into PSII only after D1/D2 assembly . This sequential assembly process is difficult to recapitulate in heterologous systems.

A potential solution matrix for these challenges:

ChallengeMethodological ApproachKey Considerations
Membrane protein solubilityUse of specialized detergents (DDM, β-OG)Detergent concentration must balance solubilization with maintaining protein structure
Chlorophyll incorporationIn vitro reconstitution with purified chlorophyllRequires controlled environment and often yields partial loading
Protein foldingCell-free expression systemsCan provide more controlled folding environment
Assembly constraintsCo-expression with other PSII componentsRequires multiple gene constructs and balanced expression

Researchers have found that expressing CP47 with an N-terminal His-tag allows for purification under native conditions, though the tag position must be carefully chosen to avoid interfering with protein function .

How can Agrobacterium-mediated transformation be optimized for studying psbB in hornworts?

Optimizing Agrobacterium-mediated transformation for studying psbB in hornworts requires careful consideration of several factors based on established protocols for Anthoceros species:

  • Tissue selection: Using thallus tissue grown under low-light conditions significantly improves transformation efficiency in hornworts . This may relate to tissue metabolic state and cell wall properties.

  • Vector design for psbB studies:

    • Promoter selection: While CaMV 35S promoter works effectively in hornworts , using native psbB promoters may better preserve regulatory elements

    • Reporter fusion considerations: C-terminal fusions are preferable to N-terminal fusions to preserve chloroplast targeting

    • Selection marker: Hygromycin resistance (hph gene) has proven effective for selecting hornwort transformants

  • Transformation protocol optimization:

    • Agrobacterium strain: AGL1 or similar strains with enhanced plant transformation capacity

    • Co-cultivation period: 2-3 days under dim light conditions

    • Multi-stage selection: Implementing three rounds of antibiotic selection ensures elimination of false positives

When specifically studying psbB function, researchers should consider generating constructs that enable:

  • Visualization of CP47 localization through fluorescent protein fusions

  • Mutation analysis through site-directed mutagenesis

  • Promoter activity studies using reporter genes

This approach has been successfully demonstrated in Anthoceros agrestis, achieving high transformation efficiency with multiple reporter constructs including GUS and fluorescent proteins .

What techniques are most effective for analyzing CP47 protein interactions within Photosystem II?

Analyzing CP47 protein interactions within Photosystem II requires a multi-faceted approach combining biochemical, biophysical, and genetic techniques:

  • Co-immunoprecipitation (Co-IP): Using CP47-specific antibodies to pull down the protein complex allows identification of interacting partners. This technique has revealed that CP47 interacts directly with D1, D2, and several other PSII subunits .

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This technique separates protein complexes in their native state and can reveal the assembly state of PSII containing CP47. Combined with second-dimension SDS-PAGE, it provides detailed information about complex composition.

  • Cross-linking Mass Spectrometry (XL-MS): Chemical cross-linking of proteins followed by mass spectrometry analysis identifies specific interaction sites between CP47 and other PSII components.

  • FRET Analysis: Fluorescence Resonance Energy Transfer using recombinant CP47 with fluorescent tags can measure interaction distances and dynamics between protein subunits.

  • Yeast Two-Hybrid and Split-GFP Systems: While challenging for membrane proteins, modified versions of these assays can assess specific domain interactions of CP47.

A comparative effectiveness analysis of these methods reveals:

TechniqueAdvantagesLimitationsBest Application
Co-IPIdentifies natural complexesMay detect indirect interactionsInitial complex composition analysis
BN-PAGEPreserves native complexesLimited resolutionAssembly state determination
XL-MSProvides residue-level interaction dataComplex data analysisDetailed structural mapping
FRETMeasures interactions in live systemsRequires fluorescent taggingDynamic interaction studies
Y2H/Split-GFPTests specific interactionsOften fails with full membrane proteinsDomain-specific interaction testing

The most comprehensive approach combines these techniques, allowing researchers to correlate structural data with functional insights about CP47's role in PSII assembly and function .

How can researchers effectively measure chlorophyll binding properties of recombinant CP47?

Measuring chlorophyll binding properties of recombinant CP47 requires specialized techniques that address both quantitative and qualitative aspects of pigment-protein interactions:

  • Absorption Spectroscopy: The chlorophyll binding characteristics of CP47 create distinctive absorption peaks in the visible spectrum. Purified recombinant CP47 should exhibit characteristic absorption maxima at approximately 675-680 nm, corresponding to bound chlorophyll a molecules.

  • Fluorescence Spectroscopy: This provides information about the energy transfer properties of bound chlorophylls. The emission spectrum of properly folded CP47 with bound chlorophylls shows characteristic peaks and energy transfer efficiency.

  • Circular Dichroism (CD): CD spectroscopy in the visible region reveals the arrangement of chlorophylls within the protein structure, providing information about their orientation and interaction.

  • Pigment Extraction and HPLC Analysis: This quantitative approach involves:

    • Extraction of pigments using organic solvents (acetone/methanol mixtures)

    • Separation by HPLC

    • Quantification against standards

    • Determination of chlorophyll a:b ratios and total binding capacity

  • Isothermal Titration Calorimetry (ITC): For measuring binding affinities and thermodynamic parameters of chlorophyll association with recombinant CP47.

For functional validation, researchers should compare the spectroscopic properties of recombinant CP47 with those of the native protein isolated from Anthoceros formosae thylakoid membranes. Significant deviations in absorption or fluorescence characteristics may indicate improper folding or incomplete chlorophyll incorporation in the recombinant protein.

What is the optimal protocol for RNA extraction and analysis when studying psbB expression in hornworts?

Studying psbB expression in hornworts requires specialized RNA extraction and analysis protocols that account for the unique characteristics of hornwort tissue and the complexity of chloroplast RNA metabolism:

  • RNA Extraction Protocol:

    • Tissue preparation: Collect young thallus tissue grown under controlled light conditions (preferably low-light as used in transformation studies)

    • Homogenization: Flash freeze in liquid nitrogen and grind to fine powder

    • Extraction: Use a modified CTAB method with high salt concentration (2M NaCl) to reduce polysaccharide contamination

    • Purification: Include a LiCl precipitation step (2-3M final concentration) to selectively enrich for RNA

    • DNase treatment: Critical for removing chloroplast DNA contamination

  • Analysis of psbB Transcripts:

    • Northern blotting: Use strand-specific probes to detect the various processed forms of psbB transcripts

    • RT-PCR: Design primers that can distinguish between unprocessed polycistronic and processed monocistronic transcripts

    • RNA editing analysis: Use PCR amplification of cDNA followed by sequencing to identify RNA editing sites

    • 5' and 3' RACE: Essential for mapping the termini of processed transcripts

  • Quantitative Analysis:

    • qRT-PCR: For quantitative assessment of psbB transcript levels

    • RNA-Seq: For comprehensive analysis of all chloroplast transcripts including psbB

    • Circular RT-PCR: For detecting and quantifying circular RNA forms that may be present in chloroplasts

When analyzing psbB expression, researchers should consider the complex post-transcriptional processing events that occur in the chloroplast, including intercistronic processing, splicing of introns in adjacent genes, and RNA editing . These processes create a diverse pool of RNA molecules derived from the psbB operon, requiring careful primer design and analysis approaches to fully characterize expression patterns.

How does CP47 from Anthoceros formosae compare structurally and functionally to CP47 from other photosynthetic organisms?

CP47 from Anthoceros formosae represents an important evolutionary intermediary between algal and higher plant versions of this protein. Comparative analysis reveals significant structural and functional characteristics:

Organism GroupKey CP47 Structural FeaturesFunctional Distinctions
Cyanobacteria (e.g., Synechocystis)Simpler extrinsic domain structureDirect interaction with phycobilisomes
Hornworts (Anthoceros)Intermediate complexityPossible adaptations for terrestrial light conditions
Higher plantsMore complex lumenal loopsInteraction with expanded set of auxiliary proteins

The CP47 protein in hornworts like Anthoceros formosae likely reflects their evolutionary position as early land plants, potentially showing adaptations that facilitated the transition to terrestrial environments while maintaining the core functional architecture seen across oxygenic photosynthetic organisms .

What insights can transcriptomic analysis provide about psbB regulation in Anthoceros formosae?

Transcriptomic analysis of psbB in Anthoceros formosae can reveal regulatory mechanisms unique to hornworts and provide evolutionary insights into land plant chloroplast gene expression:

  • Expression Pattern Analysis:

    • Developmental regulation: Transcriptomic data can reveal how psbB expression changes during different developmental stages of the hornwort life cycle

    • Light response: Analysis of samples from different light conditions can illustrate how psbB transcription and processing respond to environmental signals

    • Tissue specificity: Comparison between thallus, rhizoid, and sporophyte tissues can reveal tissue-specific expression patterns

  • RNA Processing Dynamics:

    • Polycistronic transcript processing: Transcriptomics can reveal the relative abundance of different processed forms derived from the psbB operon

    • RNA editing sites: Deep sequencing can identify all RNA editing sites in psbB transcripts, providing insights into this critical post-transcriptional modification in hornworts

    • Splicing efficiency: For adjacent genes in the operon that contain introns (like petB and petD in vascular plants), transcriptomics can reveal splicing patterns

  • Regulatory Element Identification:

    • Promoter activity: 5' end mapping can identify transcription start sites and associated promoter elements

    • Stabilizing elements: Comparative analysis of transcript abundance can reveal sequences that enhance RNA stability

    • Processing signals: Identification of conserved sequences at processing sites

Transcriptomic analysis of hornwort chloroplast gene expression provides a unique window into early land plant biology. The psbB gene's expression in Anthoceros formosae likely shows both conserved features shared with all land plants and unique characteristics reflecting hornworts' distinct evolutionary position and ecological adaptations .

How can researchers correlate psbB sequence variations with functional differences in CP47 across hornwort species?

Correlating psbB sequence variations with functional differences in CP47 across hornwort species requires an integrated approach combining comparative genomics, biochemical analysis, and functional assays:

  • Comparative Sequence Analysis:

    • Multiple sequence alignment of psbB genes from diverse hornwort species

    • Identification of conserved domains versus variable regions

    • Calculation of selection pressures (dN/dS ratios) to identify regions under purifying or positive selection

    • Mapping variations to known functional domains of CP47

  • Structure-Function Prediction:

    • Homology modeling of CP47 proteins from different hornwort species

    • Prediction of how amino acid substitutions affect chlorophyll binding sites

    • Analysis of changes in transmembrane domains and extrinsic loops

    • Prediction of altered protein-protein interaction interfaces

  • Functional Validation Approaches:

    • Recombinant expression of CP47 variants from different species

    • Spectroscopic analysis to assess chlorophyll binding properties

    • Transformation studies using the Agrobacterium-mediated technique established for Anthoceros agrestis

    • Site-directed mutagenesis to test specific residue contributions

  • Correlation with Ecological Adaptations:

    • Analysis of psbB variations in hornworts from different habitats

    • Measurement of photosynthetic efficiency parameters in different species

    • Testing stress responses (light, temperature, desiccation) in relation to CP47 variants

Researchers can incorporate transformation techniques developed for Anthoceros agrestis to generate transgenic lines expressing different CP47 variants, allowing direct observation of functional differences in vivo . The comparative approach provides insights not only into hornwort biology but also into the fundamental structure-function relationships in Photosystem II across evolutionary time.

What are the most promising applications of Anthoceros formosae CP47 in photosynthesis research?

The CP47 protein from Anthoceros formosae offers several unique research opportunities at the intersection of evolutionary biology and photosynthesis research:

  • Evolutionary Studies of Photosystem II:

    • Hornworts represent an important evolutionary position as early land plants

    • CP47 from Anthoceros formosae provides insight into the adaptation of photosynthetic machinery during the transition to land

    • Comparative studies with algal and higher plant CP47 can reveal evolutionary trajectories of this critical protein

  • Structure-Function Studies:

    • Site-directed mutagenesis of recombinant Anthoceros CP47 to identify critical residues

    • Investigation of how hornwort-specific CP47 features contribute to photosynthetic efficiency

    • Analysis of chlorophyll-protein interactions in diverse evolutionary contexts

  • Synthetic Biology Applications:

    • Engineering chimeric CP47 proteins incorporating features from different evolutionary lineages

    • Testing the compatibility of Anthoceros CP47 with photosystems from other organisms

    • Developing optimized photosynthetic systems incorporating beneficial features from hornwort CP47

  • Environmental Adaptation Studies:

    • Investigation of how hornwort CP47 contributes to these plants' ability to thrive in diverse habitats

    • Analysis of CP47 role in desiccation tolerance and low-light adaptation

    • Comparative stress response studies across evolutionary lineages

The unique position of hornworts in plant evolution makes their photosynthetic components particularly valuable for understanding both the fundamental mechanisms of photosynthesis and the evolutionary adaptations that enabled plant diversification. The establishment of transformation techniques for hornworts opens new avenues for experimental manipulation of CP47 and other photosynthetic components in these important model organisms.

How might CRISPR-Cas technologies be applied to study psbB function in hornworts?

CRISPR-Cas technologies offer promising approaches for studying psbB function in hornworts, though they require adaptation to the unique genetic characteristics of these plants:

  • Chloroplast Genome Editing in Hornworts:

    • Direct chloroplast transformation with CRISPR-Cas9 delivered via biolistics

    • Design of hornwort-specific chloroplast promoters to drive Cas9 expression

    • Development of specific sgRNAs targeting the psbB gene

    • Selection strategies using spectinomycin or similar antibiotics for chloroplast transformants

  • Nuclear-encoded CRISPR Systems for Plastid Targeting:

    • Agrobacterium-mediated transformation of hornworts with nuclear-encoded, chloroplast-targeted Cas9

    • Use of transit peptides to ensure chloroplast import of the Cas9 protein

    • Multiplex sgRNA approaches to target multiple regions of psbB simultaneously

    • Temporal control of editing using inducible promoters

  • Specific Editing Applications for psbB Research:

    • Knockout studies: Complete disruption of psbB to assess loss-of-function phenotypes

    • Point mutations: Precise editing of critical chlorophyll-binding residues

    • Domain swapping: Replacing specific regions with sequences from other species

    • Promoter editing: Modifying regulatory elements to alter expression patterns

  • Technical Considerations for Hornwort Genome Editing:

    • Optimization of DNA delivery to chloroplasts in hornwort cells

    • Development of efficient regeneration protocols for edited tissues

    • Methods for achieving homoplasmy (complete replacement of all chloroplast genome copies)

    • Strategies for distinguishing edited plants from wild-type escapes

The established Agrobacterium-mediated transformation system for hornworts provides a foundation for delivering nuclear-encoded CRISPR components . While direct chloroplast genome editing remains technically challenging, advances in this area would enable precise manipulation of psbB to examine the functions of specific domains and residues in CP47.

What methodological advances are needed to improve recombinant expression of functional CP47 protein?

Improving recombinant expression of functional CP47 protein requires addressing several technical challenges through methodological innovations:

  • Enhanced Expression Systems:

    • Development of specialized chloroplast-mimicking expression hosts

    • Engineering of E. coli strains with enhanced membrane protein production capabilities

    • Exploration of eukaryotic expression systems (yeast, algal cells) that may better support photosynthetic protein folding

    • Cell-free expression systems with controlled redox environments and chaperone supplementation

  • Improved Solubilization and Purification Approaches:

    • Novel detergent formulations specifically optimized for photosystem proteins

    • Nanodiscs and other membrane-mimetic systems for stabilizing CP47

    • Affinity tag designs that minimize interference with protein function but enhance purification yield

    • On-column refolding protocols for recovering functional protein from inclusion bodies

  • Chlorophyll Incorporation Strategies:

    • Co-expression with chlorophyll biosynthesis enzymes

    • Development of in vitro reconstitution protocols with improved efficiency

    • Photosynthetic host systems that naturally synthesize chlorophyll

    • Design of artificial chlorophyll analogs with enhanced binding properties

  • Functional Validation Technologies:

    • High-throughput spectroscopic assays for rapid screening of protein function

    • Single-molecule approaches to assess protein dynamics and behavior

    • Cryo-EM and other structural biology techniques adapted for rapid assessment of protein folding

    • Functional assays measuring energy transfer efficiency in reconstituted systems

Methodological ChallengeCurrent LimitationsProposed Innovations
Membrane protein expressionPoor folding, inclusion body formationSpecialized expression hosts, membrane-mimetic systems
Chlorophyll incorporationInefficient binding, improper orientationCo-expression with biosynthetic enzymes, improved reconstitution
Functional assessmentLimited throughput, complex measurementsHigh-throughput spectroscopic assays, single-molecule approaches
Protein stabilityShort half-life of purified proteinNovel stabilizing agents, optimized buffer systems

Advances in these areas would not only improve the study of Anthoceros formosae CP47 but would also benefit research on other complex photosynthetic proteins, potentially leading to broader applications in synthetic biology and bioenergy research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.