Recombinant Anthoceros formosae Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

The PsbA protein, encoded by the psbA gene, forms the reaction center of PSII. It binds cofactors involved in electron transfer, including pheophytin and plastoquinone, and facilitates water oxidation . In Anthoceros formosae (a hornwort), recombinant PsbA enables mechanistic studies of PSII under controlled conditions, bypassing challenges associated with native protein extraction .

Primary Structure

  • Amino Acid Sequence: 344 residues (1–344 aa) .

  • Key Domains:

    • N-terminal His-tag for affinity purification.

    • Transmembrane helices critical for PSII assembly .

    • Active sites for plastoquinone (Q<sub>B</sub>) binding and photodamage repair .

Physical Properties

ParameterDescription
Molecular Weight~39 kDa (calculated)
Purity>90% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C; Tris/PBS buffer with 6% trehalose, pH 8.0
Reconstitution0.1–1.0 mg/mL in sterile water; 50% glycerol for long-term storage

Role in Photosynthesis

  • Electron Transport: PsbA mediates electron transfer from water to plastoquinone via a tyrosine residue (Y<sub>Z</sub>) .

  • Photoprotection: The D1 protein undergoes rapid turnover due to photodamage, making recombinant PsbA vital for studying repair mechanisms .

Mutational Studies

  • Y112 Mutants: Substitutions (e.g., Y112F, Y112L) alter PSII activity and thermoluminescence signals, highlighting PsbA’s role in redox equilibria .

  • Herbicide Binding: PsbA is the target of herbicides like atrazine, which block Q<sub>B</sub> binding .

Key Studies

  1. PSII Assembly:

    • PsbA interacts with assembly factors (e.g., HCF244, OHP1/OHP2) to regulate psbA mRNA translation and D1 integration into PSII .

    • Disruption of assembly factors reduces ribosome occupancy on psbA mRNA, impairing PSII biogenesis .

  2. Evolutionary Analysis:

    • The psbA gene in A. formosae shares 70–80% sequence identity with cyanobacterial homologs, reflecting conserved functional domains .

  3. Structural Biology:

    • Recombinant PsbA enables crystallographic studies of PSII’s oxygen-evolving complex (OEC) and chlorophyll-binding sites .

Comparative Analysis with Other Species

FeatureA. formosae PsbA Prorocentrum micans PsbA Heterocapsa triquetra PsbA
Length (aa)344343348
His-Tag PositionN-terminalN-terminalN-terminal
Key ResiduesY112, H272Q130, M173F147, A270
Expression HostE. coliE. coliE. coli

Future Directions

  • Photodamage Mechanisms: Use recombinant PsbA to study UV-induced degradation and repair kinetics .

  • Herbicide Resistance: Engineer PsbA mutants to explore resistance pathways in crops .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will strive to accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Anthoceros formosae (Hornwort)
Target Names
psbA
Target Protein Sequence
MTATLERRESASLWGRFCDWVTSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently utilized for ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of the psbA gene in Anthoceros formosae?

The psbA gene in Anthoceros formosae is located in the chloroplast genome, which has been completely sequenced and found to be 161,162 bp in length - the largest genome reported among land plant chloroplasts. The chloroplast genome is divided into two regions by a pair of inverted repeat regions (IR) of 15,744 bp each, with large and small single copy regions of 107,503 and 22,171 bp, respectively . The psbA gene encodes the Photosystem Q(B) protein (D1 protein), which consists of 344 amino acids and plays a crucial role in the electron transport chain of Photosystem II .

What expression systems are recommended for producing recombinant Anthoceros formosae psbA protein?

For producing recombinant A. formosae psbA protein, several expression systems can be considered based on research requirements:

  • Bacterial Expression Systems: E. coli systems offer high protein yields and are cost-effective. For the 344-amino acid psbA protein, codon optimization is crucial to overcome differences between chloroplast and bacterial codon usage patterns.

  • Plant-Based Expression Systems: Transformation techniques using Agrobacterium-mediated methods have been successfully developed for hornworts, specifically for Anthoceros agrestis, and similar approaches could be adapted for heterologous expression of psbA . This system maintains the plant cellular environment, which may be advantageous for proper folding and post-translational modifications.

  • Cell-Free Expression Systems: These can be beneficial for membrane proteins like psbA to avoid toxicity issues often encountered in cellular systems.

For optimal results, the expression vector should include appropriate regulatory elements, and the recombinant protein should ideally include a purification tag that minimally impacts protein structure and function.

What purification strategies yield highest purity of recombinant psbA protein?

Purification of recombinant psbA requires a multi-step approach due to its hydrophobic nature as a membrane protein:

  • Initial Extraction: Use of specialized detergents (n-dodecyl-β-D-maltoside or digitonin) to solubilize the protein from membranes while maintaining structural integrity.

  • Immobilized Metal Affinity Chromatography (IMAC): If the recombinant protein contains a histidine tag, IMAC provides an effective first purification step.

  • Size Exclusion Chromatography: This helps separate monomeric psbA from aggregates and other proteins of different molecular weights.

  • Ion Exchange Chromatography: A final polishing step to remove remaining contaminants based on charge differences.

Purification should be performed at 4°C with protease inhibitors to prevent degradation. The buffer composition is critical, usually containing glycerol (25-50%) for stability, as seen in commercial preparations .

How can researchers verify the functional integrity of purified recombinant psbA?

Functional verification of recombinant psbA can be performed through multiple complementary approaches:

Researchers should compare the recombinant protein's properties with those of native psbA isolated from A. formosae thylakoid membranes to ensure proper folding and function.

What structural differences exist between psbA proteins of Anthoceros formosae and other photosynthetic organisms?

The psbA protein (D1) shows both conservation and variation across photosynthetic lineages. Key structural differences include:

  • Amino Acid Substitutions: Comparative analysis of the A. formosae psbA sequence (Q85BH5) reveals specific amino acid differences in functional domains. For example, the full sequence of the 344-amino acid protein contains regions that differ from cyanobacterial counterparts, particularly in quinone-binding regions .

  • Quinone Binding Site Architecture: Research on cyanobacterial psbA variants reveals that subtle changes in the QB binding pocket significantly impact electron transport efficiency. In Thermosynechococcus elongatus, the change from Ser270 to Ala270 in the D1 protein affects the hydrogen bonding with sulfoquinovosyl-diacylglycerol near QB, influencing plastoquinone exchange dynamics . Similar structural variations may exist in the A. formosae protein.

  • Pheophytin Interaction Sites: Specific residues like D1-130 and D1-Y147 that form hydrogen bonds with pheophytin can vary across species, affecting the redox potential of electron acceptors .

These structural differences likely reflect evolutionary adaptations to different environmental conditions and may influence protein stability, redox properties, and repair mechanisms.

How do post-translational modifications affect psbA protein function in hornworts?

Post-translational modifications (PTMs) of psbA in hornworts remain less thoroughly characterized than in model organisms, but likely include:

  • Phosphorylation: Phosphorylation of specific residues (typically N-terminal threonines) in psbA regulates the protein damage-repair cycle. In high light conditions, phosphorylation facilitates migration of damaged D1 from grana to stroma thylakoids for degradation and replacement.

  • Oxidative Modifications: Reactive oxygen species produced during photosynthesis can modify specific amino acids, particularly those containing sulfur (methionine, cysteine). These modifications often indicate protein damage requiring repair.

  • N-terminal Processing: The mature psbA protein typically undergoes N-terminal processing during integration into the thylakoid membrane.

Analysis of the A. formosae psbA sequence reveals potential phosphorylation sites at N-terminal threonine residues (e.g., at position 2) , which could be functionally significant. Research methodologies to investigate these PTMs should include phosphoproteomic analysis, site-directed mutagenesis of potential modification sites, and functional assays under different environmental conditions.

What experimental approaches can resolve contradictory data regarding psbA interactions with other photosystem components?

Contradictory findings regarding psbA interactions with other photosystem components can be resolved through multi-faceted approaches:

  • In vitro Reconstitution Studies: Systematic assembly of purified components with recombinant A. formosae psbA under controlled conditions to define minimal requirements for interactions.

  • Cross-linking Mass Spectrometry: Chemical cross-linking followed by mass spectrometry analysis can identify protein-protein interaction interfaces with residue-level precision.

  • Cryo-Electron Microscopy: High-resolution structural determination of intact photosystem complexes containing psbA to visualize interaction surfaces.

  • Hydrogen-Deuterium Exchange Mass Spectrometry: This identifies protein regions with altered solvent accessibility upon binding, providing evidence for interaction interfaces.

  • FRET-based Interaction Analysis: For fluorescently labeled proteins to measure distances between components in real-time.

To ensure reliable results, researchers should:

  • Use multiple complementary techniques

  • Verify interactions in different experimental systems (in vitro vs. in vivo)

  • Control for detergent and buffer effects that may disrupt or promote artificial interactions

  • Compare wild-type and mutant proteins to validate specific interaction sites

How can site-directed mutagenesis be used to investigate functional domains in Anthoceros formosae psbA?

Site-directed mutagenesis of A. formosae psbA provides powerful insights into structure-function relationships. A systematic approach should include:

  • Target Selection Based on Sequence Conservation: Highly conserved residues across species likely serve critical functions. The psbA amino acid sequence reveals numerous conserved residues in transmembrane and functional domains .

  • Functional Domain Analysis:

    • QB Binding Pocket: Mutations in residues like D1-Ser270 (which in some species is Ala270) can alter quinone binding and electron transfer rates .

    • Coordination Sphere of Mn4CaO5 Cluster: Mutations in residues that coordinate the oxygen-evolving complex can reveal their role in water oxidation.

    • Pheophytin Interaction Residues: Changes to D1-130 position can alter hydrogen bonding with pheophytin and affect redox potentials .

  • Mutation Design Strategy:

    • Conservative substitutions to test the importance of specific chemical properties

    • Charge reversals to disrupt electrostatic interactions

    • Introduction of bulky residues to probe spatial constraints

  • Expression and Functional Testing:

    • Heterologous expression in cyanobacterial or plant systems

    • Measurement of oxygen evolution rates

    • Electron transfer kinetics

    • Photodamage susceptibility and repair rates

The recent development of transformation techniques for hornworts opens possibilities for homologous expression systems for these mutations .

What are the optimal conditions for expressing recombinant Anthoceros formosae psbA in heterologous systems?

Optimal expression conditions for recombinant A. formosae psbA vary by expression system:

Table 1: Optimization Parameters for Recombinant psbA Expression

ParameterE. coli SystemPlant-Based SystemCell-Free System
Temperature16-20°C22-25°C20-30°C
Induction0.1-0.5 mM IPTGLight/dark cyclesN/A
Duration16-24 hours3-4 weeks4-24 hours
Media Supplements5-10% glycerol, membrane-promoting agentsSucrose 2-3%Lipids/detergents
Special ConsiderationsCodon optimization essentialUse of acetosyringone for Agrobacterium transformation Addition of chlorophyll

For eukaryotic expression systems, co-expression with chlorophyll synthesis genes and chaperones may improve folding. When using Agrobacterium-mediated transformation (as demonstrated for A. agrestis), optimization can be achieved by using thallus tissue grown under low-light conditions and conducting co-cultivation for approximately 3 days at 22°C .

What analytical techniques provide the most reliable structural information about recombinant psbA protein?

Multiple complementary techniques provide comprehensive structural insights:

  • X-ray Crystallography: Provides atomic-level resolution but requires highly pure, homogeneous protein crystals. For membrane proteins like psbA, crystallization in detergent micelles or lipidic cubic phases may be necessary.

  • Cryo-Electron Microscopy: Increasingly used for membrane protein complexes, allowing visualization in near-native states without crystallization. Has revealed detailed structures of photosystem II from cyanobacteria .

  • Nuclear Magnetic Resonance (NMR): Useful for studying specific domains or dynamic regions, though challenging for the entire membrane protein.

  • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure content and can monitor thermal stability.

  • Hydrogen-Deuterium Exchange Mass Spectrometry: Maps solvent-accessible regions and can detect conformational changes upon binding of cofactors.

For each technique, sample preparation is critical—particularly detergent selection for membrane protein extraction. The choice between n-dodecyl-β-D-maltoside, digitonin, or other detergents can significantly impact structural integrity and function.

How can researchers distinguish between native and recombinant psbA protein functions in experimental systems?

Distinguishing native from recombinant psbA requires careful experimental design:

  • Epitope Tagging: Addition of small tags (His, FLAG) to recombinant protein allows specific detection and purification without significantly affecting function.

  • Species-Specific Antibodies: Development of antibodies that recognize unique epitopes in A. formosae psbA but not homologous proteins from host organisms.

  • Mass Spectrometry Identification: Detection of species-specific peptides following tryptic digestion can definitively identify protein origin.

  • Genetic Backgrounds: Expression in psbA deletion mutants of cyanobacteria or plants ensures all psbA function comes from the recombinant protein.

  • Functional Complementation Assays: Testing whether recombinant A. formosae psbA restores photosynthetic capacity in psbA-deficient mutants.

For each approach, appropriate controls should include parallel analysis of native psbA from A. formosae, host-derived psbA, and negative controls lacking psbA.

How can recombinant Anthoceros formosae psbA protein be used to study evolution of photosynthesis?

The hornwort A. formosae represents an important evolutionary position among land plants, making its psbA protein valuable for evolutionary studies:

  • Phylogenetic Analysis: Comparing psbA sequences and structures across the green plant lineage can reveal evolutionary relationships and selection pressures. A. formosae's chloroplast genome has unique features compared to other land plants, including the largest known genome size among land plant chloroplasts (161,162 bp) .

  • Ancestral State Reconstruction: Identifying conserved features versus hornwort-specific innovations in psbA structure and function.

  • Functional Comparison Across Lineages: Expression of psbA proteins from different evolutionary lineages in standardized backgrounds to compare photosynthetic efficiency, stress tolerance, and repair mechanisms.

  • Horizontal Gene Transfer Investigation: Analysis of tufA-like fragments found in A. formosae (between psbE and petL) and other species can provide insights into plastid gene transfer events during land plant evolution .

Research approaches should include reconstruction of ancestral psbA sequences, expression of chimeric proteins combining domains from different lineages, and correlation of sequence changes with adaptations to terrestrial environments.

What are the critical parameters for successful crystallization of recombinant psbA for structural studies?

Crystallization of membrane proteins like psbA presents significant challenges. Critical parameters include:

Table 2: Crystallization Parameters for Recombinant psbA Protein

ParameterRecommended ApproachRationale
Protein Purity>95% homogeneityContaminants interfere with crystal packing
Detergent Selectionn-dodecyl-β-D-maltoside or digitoninMaintains native-like environment while allowing crystal contacts
Lipid Addition0.1-1.0 mg/mL specific lipidsStabilizes protein in native conformation
Crystallization MethodVapor diffusion or lipidic cubic phaseLCP often superior for membrane proteins
Additive ScreeningPEG 400, glycerol, specific ionsCan stabilize specific conformations
Temperature4-18°CReduces protein flexibility and degradation
Cofactor AdditionChlorophyll, plastoquinoneStabilizes native conformation

Learning from previous crystallization of photosystem II from cyanobacterial sources , researchers should consider the integration of psbA into larger complexes rather than crystallization of the isolated protein, as protein-protein interactions within the photosystem complex likely stabilize the structure.

How do environmental stressors influence psbA protein dynamics and turnover rates?

The psbA protein (D1) is highly susceptible to damage under environmental stress, necessitating efficient repair mechanisms:

  • High Light Stress: Accelerates photodamage to psbA, primarily through oxidative damage to specific amino acids. Detection methods include immunoblotting of degradation products and pulse-chase labeling to measure turnover rates.

  • Temperature Extremes: Can affect protein folding, membrane fluidity, and repair enzyme activity. Differential scanning calorimetry can measure thermal stability differences.

  • Drought/Osmotic Stress: Impacts thylakoid membrane integrity and electron transport. Measuring electron transport rates under controlled dehydration conditions provides insights.

A comparative approach examining stress responses across species reveals that different photosynthetic organisms have evolved varied strategies for psbA protection and repair. Studies in cyanobacteria show that different psbA genes (psbA1, psbA2, psbA3) are expressed in response to different environmental conditions, with structural differences that affect their function under stress .

For hornworts, their evolutionary position and unique chloroplast features may confer distinct stress responses worth investigating through controlled environmental chamber experiments and quantitative proteomics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.