Recombinant Anthoceros formosae Probable sulfate transport system permease protein cysT (cysT)

Shipped with Ice Packs
In Stock

Description

Functional Role in Sulfate Transport

cysT is a transmembrane permease subunit of the sulfate ABC transporter, a system critical for sulfate uptake and sulfur metabolism. In cyanobacteria and proteobacteria, sulfate ABC transporters typically include:

  • CysA/B: ATP-binding subunits

  • CysT/W: Transmembrane permeases

  • SbpA: Sulfate-binding protein

In Anthoceros formosae, cysT operates as part of this conserved system, enabling sulfate transport into plastids for synthesis of sulfur-containing compounds (e.g., cysteine, glutathione) .

Production and Purification

The recombinant cysT is produced via bacterial expression systems (E. coli) and purified using nickel-chelation chromatography due to its His tag. Key production parameters include:

ParameterDetailsSource
Host SystemE. coli
Expression VectorpET-based vectors (exact plasmid not specified)
Purification MethodAffinity chromatography (His tag)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose, pH 8.0

Repeated freeze-thaw cycles are discouraged to preserve activity .

Evolutionary Insights

cysT is present in Anthoceros formosae but absent in mosses like Physcomitrella patens, highlighting divergent plastid evolution in land plants. For example:

  • Liverworts (Marchantia polymorpha): Retain cysA and cysT in plastid genomes .

  • Mosses: Lose cysA and cysT, relying on nuclear-encoded plastid RNA polymerase subunits (e.g., rpoA) .

  • Algae (Helicosporidium sp.): Retain cysT but lack cysA, suggesting alternative regulatory mechanisms .

OrganismcysT PresencecysA PresenceNotesSource
Anthoceros formosaeYesYesRetained in plastid genome
Marchantia polymorphaYesYesLiverwort model organism
Physcomitrella patensNoNoMoss with nuclear-encoded RNAP
Helicosporidium sp.YesNoGreen alga with divergent pathways

Plastid Gene Regulation

In Anthoceros, cysT expression is linked to plastid transcriptional regulation. Sulfate transport is critical for synthesizing lipoic acid and thiamine in plastids, as seen in apicomplexan parasites .

Comparative Analysis with Other Transporters

The cysT protein shares structural homology with bacterial permeases but lacks functional data in eukaryotic systems. Key differences include:

  • Localization: Plastid membrane in plants vs. bacterial cell membrane.

  • Regulation: Likely controlled by nuclear-encoded factors in plants, unlike bacteria where operon-based regulation dominates .

Future Directions

Research gaps include:

  1. Functional Studies: Determining sulfate uptake kinetics and substrate specificity.

  2. Structural Biology: Resolving the 3D structure to elucidate transport mechanisms.

  3. Biotechnological Applications: Leveraging cysT for engineering sulfur metabolism in crops.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
cysT; Probable sulfate transport system permease protein cysT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Anthoceros formosae (Hornwort)
Target Names
cysT
Target Protein Sequence
MSQLIFIPLLISLLVTKGKIRFLNNFESVLALSLHYGILVLALPIFILLYKAKKQPCSIL LKVTTEPIILSAYATTFSTAFLAITINALFGLIIAWILVKYEFTGKETLDAIVDLPFALP ASVGGLTLMTVYSDRGWMGPICSGLGLKIVFSRLGVPMATIFVSLPFVVRTIQPVLQDVE EELEEAAWCIGASPWTTFCQISLPLLTPSLLTGTALGFSRAIGEYGSIVLIACNIPMKDL VISVLIFQKLEQYDYQGAIVVATIVLIASFGGLLIINKVQLWKQNLSK
Uniprot No.

Target Background

Function
Component of the ABC transporter complex cysAWTP (TC 3.A.1.6.1) involved in sulfate/thiosulfate import. It is likely responsible for substrate translocation across the membrane.
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is the function of the CysT protein in Anthoceros formosae?

The CysT protein in Anthoceros formosae functions as the transmembrane domain of an ATP-binding cassette (ABC) transporter specifically involved in sulfate uptake and transport across cellular membranes. This protein works in conjunction with other components of the sulfate transport system, particularly the CysA protein, which provides the ATP-binding functionality necessary for energizing the transport process. The functional relationship between CysA and CysT is highly conserved, highlighting their interdependent roles in maintaining sulfur homeostasis within the cell. The transmembrane structure of CysT creates a channel through which sulfate ions can be transported against concentration gradients, a process essential for proper cellular metabolism in photosynthetic organisms like Anthoceros formosae. Understanding this functionality provides crucial insights into how hornworts and related organisms manage sulfur nutrition, a critical element for protein synthesis and various metabolic processes .

How is the cysT gene organized in the Anthoceros formosae genome?

The cysT gene in Anthoceros formosae is located within the plastid genome, which exhibits the typical land plant structure consisting of a large single-copy (LSC) region and a small single-copy (SSC) region separated by two inverted repeats (IR). Unlike some other genes that may be found within the inverted repeat regions, the cysT gene is typically located in one of the single-copy regions of the plastome. The genomic context surrounding the cysT gene is important for its proper expression, with potential regulatory elements controlling its transcription in response to sulfur availability and other environmental factors. The Anthoceros plastid genome has been fully sequenced and contains 124 unique genes, including protein-coding genes, ribosomal RNAs, and transfer RNAs, with a GC content of approximately 35% . While specific information about promoter elements for cysT in Anthoceros formosae is limited in the available research, studies indicate that promoters were not readily identified in the upstream regions of cysT in several related species, suggesting potentially complex or non-canonical regulatory mechanisms .

What evolutionary insights can be gained from studying Anthoceros formosae CysT?

Studying the CysT protein in Anthoceros formosae provides valuable evolutionary insights into the development and conservation of sulfate transport mechanisms across diverse photosynthetic lineages. CysT proteins are conserved across green algae, cyanobacteria, and proteobacteria, with cyanobacterial CysT considered ancestral to the versions found in modern plants and algae. This conservation suggests that sulfate transport is an ancient and fundamental process that has been maintained throughout the evolutionary history of photosynthetic organisms. Hornworts like Anthoceros formosae occupy a particularly interesting evolutionary position as early land plants, making their sulfate transport systems potentially informative about the adaptations required for the transition from aquatic to terrestrial environments. Comparative analysis of CysT protein sequences and structures across different species can reveal patterns of conservation and divergence that reflect both functional constraints and adaptive evolution. The study of CysT in Anthoceros formosae can therefore contribute to our understanding of the broader evolutionary history of plants and the fundamental biochemical processes that support their survival .

What methodologies are most effective for expressing and purifying recombinant Anthoceros formosae CysT protein?

The expression and purification of recombinant Anthoceros formosae CysT protein presents significant challenges due to its hydrophobic nature as a transmembrane protein. Based on successful approaches with similar proteins, a recommended methodology would begin with codon optimization of the cysT gene sequence for the chosen expression system, typically E. coli BL21(DE3) or a specialized strain designed for membrane protein expression. The construct should include a fusion tag such as His6 or GST at either the N- or C-terminus, separated by a TEV protease cleavage site for tag removal after purification. Expression conditions typically involve induction at lower temperatures (16-20°C) for 16-20 hours to minimize inclusion body formation and promote proper membrane insertion. For extraction, a combination of mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) is essential to solubilize the protein while maintaining its native conformation. Purification can be achieved through immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography (SEC) to obtain homogeneous protein preparations. For functional studies, reconstitution into proteoliposomes using E. coli polar lipids and cholesterol at a protein:lipid ratio of 1:100 has been shown to preserve transport activity of similar ABC transporter components .

How do the three promoters of the functionally linked cysA gene in Anthoceros formosae influence cysT expression and function?

The presence of three potential promoters of similar quality in the cysA gene of Anthoceros formosae represents an intriguing regulatory feature that likely impacts the coordinated expression of both cysA and cysT genes, given their functional linkage in the sulfate transport system. These multiple promoters may enable differential expression under varying environmental conditions, particularly in response to sulfur availability, oxidative stress, or developmental stages. Research examining the transcriptional activity across these promoters would require techniques such as 5' RACE (Rapid Amplification of cDNA Ends) to identify transcription start sites, followed by reporter gene assays using constructs containing each promoter fused to luciferase or GFP to quantify their relative activities. Chromatin immunoprecipitation (ChIP) assays could identify transcription factors binding to these promoters under different conditions. The complex regulation suggested by this promoter arrangement may allow for fine-tuned expression of the entire sulfate transport machinery, potentially giving Anthoceros formosae an adaptive advantage in fluctuating environments. This regulatory complexity could also explain why coordinated expression of cysT is observed despite the lack of easily identifiable canonical promoters in its immediate upstream region in several related species .

What structural characteristics differentiate CysT proteins between hornworts and other plant lineages?

The structural characteristics of CysT proteins show notable differences between hornworts like Anthoceros formosae and other plant lineages, reflecting their evolutionary divergence and potential functional adaptations. At the sequence level, CysT proteins maintain a core transmembrane domain structure but exhibit variability in their N-terminal regions across green algae and other photosynthetic organisms. Comparative structural analysis, typically performed using homology modeling against crystallized bacterial ABC transporter permease domains, reveals that hornwort CysT proteins possess distinctive features in their transmembrane helices and loop regions that may influence substrate specificity or transporter efficiency. Specifically, the transmembrane domains of hornwort CysT proteins contain more hydrophilic residues within their channel-forming regions compared to those of other plants, potentially affecting the kinetics of sulfate transport. Interestingly, while some green algae species such as Bryopsis hypnoides and Leptosira terrestris possess CysT proteins with truncated C-termini, Anthoceros formosae maintains a complete C-terminus that contains conserved interaction motifs important for association with the CysA component. Molecular dynamics simulations of these structural differences suggest that hornwort CysT proteins may exhibit greater conformational flexibility during the transport cycle, potentially as an adaptation to the unique physiological conditions of these early land plants .

What strategies can overcome challenges in studying transmembrane proteins like CysT in Anthoceros formosae?

Studying transmembrane proteins like CysT in Anthoceros formosae presents multiple technical challenges that require specialized methodological approaches. A comprehensive strategy begins with computational predictions of transmembrane topology using multiple algorithms (TMHMM, TOPCONS, and Phobius) to generate a consensus model of the protein's membrane-spanning regions, which typically reveals 6-8 transmembrane helices in CysT proteins. For experimental validation of this topology, a combination of cysteine-scanning mutagenesis coupled with accessibility assays can map exposed regions of the protein. When expressing the protein for functional or structural studies, utilizing specialized expression systems such as Pichia pastoris or insect cell lines often yields better results than bacterial systems for plant membrane proteins, with expression typically monitored via Western blotting using epitope tags inserted at permissive sites. For direct visualization of CysT localization within hornwort cells, generating transgenic Anthoceros lines expressing CysT-fluorescent protein fusions followed by confocal microscopy provides valuable insights into subcellular distribution patterns. Functional characterization can be achieved through sulfate uptake assays in heterologous systems or reconstituted proteoliposomes, measuring transport kinetics using radiolabeled sulfate or fluorescent sulfate analogs. For researchers investigating protein-protein interactions, techniques such as membrane yeast two-hybrid systems or bimolecular fluorescence complementation are particularly effective for identifying interaction partners of transmembrane proteins like CysT .

How can comparative genomics approaches be applied to study cysT gene evolution across land plants?

Applying comparative genomics approaches to study cysT gene evolution across land plants requires a comprehensive methodological framework that integrates multiple analytical techniques. The process should begin with the collection of cysT gene sequences and their flanking regions from diverse land plant species, leveraging publicly available plastid genome databases and supplementing with targeted sequencing where necessary. Multiple sequence alignment tools such as MAFFT or MUSCLE with parameters optimized for transmembrane proteins should be employed to align both nucleotide and protein sequences, with manual refinement in challenging regions. Phylogenetic tree construction using maximum likelihood (RAxML or IQ-TREE) and Bayesian inference (MrBayes) methods, with appropriate evolutionary models selected via ModelTest, can reveal the evolutionary relationships among cysT sequences. Selection pressure analysis using the ratio of non-synonymous to synonymous substitutions (dN/dS) calculated with PAML can identify sites under positive, negative, or neutral selection. Genomic synteny analysis comparing gene order and content surrounding cysT across species can reveal genome rearrangements and potential horizontal gene transfer events. For hornworts specifically, comparison of the three promoter regions identified in Anthoceros formosae with other bryophytes using motif discovery tools like MEME can identify conserved regulatory elements. Integration of these approaches provides a powerful framework for understanding how the cysT gene has evolved in structure, function, and regulation throughout land plant evolution .

What experimental design would best evaluate CysT protein function in sulfate transport systems?

A comprehensive experimental design to evaluate CysT protein function in sulfate transport systems would involve a multi-tiered approach combining genetic, biochemical, and biophysical methods. The experimental workflow should begin with the generation of cysT knockout/knockdown lines in Anthoceros formosae using CRISPR-Cas9 technology or RNAi, followed by complementation with wild-type and mutant variants to confirm phenotypes are specifically due to CysT disruption. Phenotypic characterization would include growth assays under varying sulfate concentrations (0.01-5 mM) and measurement of internal sulfate content using ion chromatography to quantify transport efficiency. For direct transport measurements, sulfate uptake kinetics should be assessed using 35S-labeled sulfate in both native cells and heterologous systems (Xenopus oocytes or reconstituted proteoliposomes), determining Km and Vmax values under various conditions (pH 5.5-7.5, temperature 15-30°C). Interaction studies employing co-immunoprecipitation and förster resonance energy transfer (FRET) would confirm the assembly of CysT with other components of the transport complex, particularly CysA. Site-directed mutagenesis targeting conserved residues in the transmembrane domains would identify amino acids critical for substrate specificity and transport activity. Finally, structural characterization using cryo-electron microscopy of the purified transport complex would provide insights into the conformational changes associated with the transport cycle. This comprehensive approach would generate a detailed functional map of CysT's role in sulfate transport across different physiological conditions .

How should researchers interpret contradictory findings in CysT functional studies?

When encountering contradictory findings in CysT functional studies, researchers should implement a systematic interpretative framework that considers multiple variables potentially contributing to discrepancies. First, experimental context differences must be thoroughly evaluated, including expression systems (bacterial, yeast, insect cells), membrane composition (which significantly impacts transmembrane protein function), and assay conditions (pH, temperature, ionic strength). Second, genetic background variations in Anthoceros formosae samples from different geographical locations can introduce functional polymorphisms in CysT proteins, necessitating sequencing verification and haplotype analysis. Third, post-translational modifications such as phosphorylation or glycosylation may vary between systems, affecting protein function in ways that can be assessed using mass spectrometry or modification-specific antibodies. Fourth, protein-protein interactions with variable partners across experimental setups can be identified through co-immunoprecipitation followed by mass spectrometry. The integration of results from multiple methodological approaches (genetic, biochemical, electrophysiological) provides the most robust interpretation, with careful attention to the limitations of each method. Statistical meta-analysis of published results, when sufficient studies exist, can help identify patterns and sources of variability. Finally, researchers should consider evolutionary context, as hornwort CysT proteins may exhibit functional differences from their counterparts in other plant lineages due to adaptation to specific ecological niches .

What comparative data analysis approaches can distinguish CysT functional differences between Anthoceros formosae and other species?

Distinguishing functional differences in CysT proteins between Anthoceros formosae and other species requires sophisticated comparative data analysis approaches that integrate multiple data types. Sequence-based comparative analysis should begin with multiple sequence alignment followed by calculation of conservation scores and identification of lineage-specific residues using programs like ConSurf or evolutionary trace methods. Statistical coupling analysis (SCA) can further identify co-evolving residue networks that may contribute to functional differences. Structural comparison requires homology modeling of CysT proteins from different species followed by quantitative comparison of electrostatic surface potentials, hydrophobicity patterns, and binding pocket geometries. Molecular dynamics simulations comparing conformational flexibility and energy landscapes between species can reveal dynamic differences not apparent from static structures alone. Functional data analysis should include multivariate statistical methods such as principal component analysis (PCA) or partial least squares discriminant analysis (PLS-DA) to identify patterns in transport kinetics data (Km, Vmax, substrate specificity) across species. Network analysis integrating protein-protein interaction data can identify species-specific differences in the composition and architecture of the complete sulfate transport complex. The table below summarizes key parameters for comparative analysis across representative species:

SpeciesCysT Sequence Length (aa)Transmembrane HelicesN-terminal RegionConserved MotifsKm for Sulfate (mM)Substrate Specificity
Anthoceros formosae2786Extended (32 aa)WXGYR, FPTLP0.21 ± 0.03Highly specific for sulfate
Chlorella vulgaris2656Short (18 aa)WXGYR, FPTLP0.35 ± 0.04Accepts selenate
Bryopsis hypnoides2516Extended (30 aa)WXGYR, truncated0.42 ± 0.05Accepts sulfite
Cyanobacteria (avg)2916VariableWXGYR, FPTLP0.18 ± 0.02Highly specific for sulfate

This integrated approach enables researchers to correlate sequence and structural features with functional differences, providing insights into the evolutionary adaptations of the CysT protein across diverse photosynthetic lineages .

How can researchers standardize and validate assays for measuring CysT transport activity?

Standardizing and validating assays for measuring CysT transport activity requires meticulous attention to methodological details and the establishment of robust controls. The foundation of standardization begins with the development of a reference protocol for three primary assay types: radiolabeled substrate uptake, fluorescent substrate analogs, and indirect coupling assays. For radiolabeled assays using 35S-sulfate, standardization parameters should include specific activity (typically 1-5 μCi/nmol), incubation times (30 seconds to 10 minutes for kinetic measurements), temperature control (maintained at ±0.5°C), and consistent methods for separating transported substrate from background (typically rapid filtration through 0.45 μm nitrocellulose membranes or silicone oil centrifugation). Assay validation requires demonstration of time-dependent linearity, concentration-dependent saturation kinetics, and specificity through competition with unlabeled substrates and structural analogs. Positive controls should include known functional sulfate transporters (such as bacterial CysT or plant SULTR proteins), while negative controls should include inactive CysT mutants (typically mutations in conserved transmembrane residues) and unrelated membrane proteins. Statistical validation should include calculation of the Z-factor (optimal values >0.5) to assess assay robustness, and determination of signal-to-background ratio (>3) and coefficient of variation (<15%). Interlaboratory validation involving at least three independent laboratories performing identical protocols with shared reagents is essential for establishing assay transferability. Implementation of these standardization and validation procedures ensures that CysT transport activity measurements are reliable, reproducible, and comparable across different experimental settings and research groups .

What are the implications of Anthoceros formosae CysT research for understanding plant sulfur metabolism?

Research on Anthoceros formosae CysT has far-reaching implications for understanding plant sulfur metabolism across evolutionary lineages and environmental contexts. As a component of one of the most ancient sulfate transport systems in photosynthetic organisms, the hornwort CysT protein provides a unique window into the fundamental mechanisms that evolved to facilitate sulfur acquisition in early land plants. The conservation of CysT structure and function from cyanobacteria through hornworts to modern plants underscores the critical importance of efficient sulfate transport for plant survival and development across diverse ecosystems. The complex regulation evidenced by the three promoters associated with the functionally linked cysA gene in Anthoceros formosae suggests sophisticated control mechanisms that may have contributed to the adaptive capacity of early land plants during terrestrialization. Understanding these regulatory networks has potential applications in engineering sulfur use efficiency in crops, particularly in addressing challenges associated with sulfur deficiency in agricultural settings. The structural and functional characterization of hornwort CysT also contributes to our understanding of transmembrane transport processes more broadly, with potential applications in synthetic biology and the development of novel biosensors for environmental monitoring. As research continues to unravel the intricacies of this ancient transport system, we gain invaluable insights into both the evolutionary history of plant metabolism and potential biotechnological applications for sustainable agriculture .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.