Recombinant Antiholin-like protein LrgA (lrgA)

Shipped with Ice Packs
In Stock

Description

Mechanism of Action and Functional Properties

LrgA regulates bacterial cell death by counteracting holin activity. Key findings include:

Inhibition of Holin-Dependent Lysis

LrgA forms high-molecular-mass oligomers via disulfide bonds, which inhibit pore formation by holins like CidA . Mutations disrupting these bonds (e.g., cysteine mutants) lead to increased cell lysis during stationary phase and biofilm maturation .

Dual Role in Metabolism and Cell Death

Recent studies reveal LrgA’s involvement in:

  • Small Molecule Transport: Facilitates pyruvate uptake under microaerobic/anaerobic conditions, aiding carbohydrate metabolism .

  • Biofilm Dynamics: Regulates lysis to control DNA release, which stabilizes biofilm matrices .

Heterologous Expression and Lysis Studies

Recombinant LrgA has been expressed in E. coli to test its holin-like activity:

Model SystemKey FindingsSource
E. coli ΔSR + LrgAInduces lysis only when co-expressed with endolysin (R), mimicking holin function
Membrane Vesicle AssaysCauses leakage of small molecules (e.g., 1–2 nm diameter), confirming pore formation

Biofilm-Related Phenotypes

ConditionLrgA Wild-TypeLrgA Cysteine Mutant
Cell LysisModerate lysisIncreased lysis
Biofilm AdhesionBasal adherenceEnhanced adhesion
Dead-Cell AccumulationLowHigh

Role in Bacterial Programmed Cell Death

LrgA participates in a holin-antiholin regulatory system analogous to eukaryotic apoptosis . This system balances lysis and survival, influencing biofilm resilience and antibiotic tolerance .

Therapeutic and Industrial Applications

  • Antibiotic Development: Targeting LrgA-CidA interactions may disrupt biofilm formation, enhancing antimicrobial efficacy .

  • Metabolic Engineering: Exploiting LrgA’s transport role could optimize microbial production of metabolites like pyruvate derivatives .

Research Challenges and Future Directions

While LrgA’s structural and functional roles are well-studied, gaps remain:

  1. Mechanistic Details: How LrgA inhibits holin pores at the molecular level.

  2. Cross-Kingdom Conservation: Functional studies of LrgA homologs in archaea and plants.

  3. Recombinant Production: Scalable methods to express functional LrgA for biotechnological use.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
lrgA; BA_5690; GBAA_5690; BAS5294; Antiholin-like protein LrgA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-143
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
lrgA
Target Protein Sequence
MSTKKVYSFLSQAFIFSAIMLISNIIATHLPIPMPSSVIGLVILFSLLCLKVIKLEQVES LGTALTGIIGFLFVPSGISVINSLGVMGQYFVQILTVIVVATVILLAVTGLFAQFILGKD EKETEDTKELKVVNKGRKHGKVA
Uniprot No.

Target Background

Function
Inhibits the expression or activity of extracellular murein hydrolases by interacting, possibly with LrgB, with the holin-like protein CidA. The LrgAB and CidA proteins may influence the proton motive force of the membrane. This protein may be involved in programmed cell death (PCD), potentially triggering PCD in response to antibiotics and environmental stresses.
Database Links

KEGG: ban:BA_5690

STRING: 260799.BAS5294

Protein Families
CidA/LrgA family, LrgA subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and cellular localization of LrgA protein?

LrgA is a membrane-associated protein with multiple transmembrane domains encoded by the lrg operon in Staphylococcus aureus. Membrane fractionation and fluorescent protein fusion studies have definitively confirmed its association with the bacterial membrane . The protein contains cysteine residues that participate in disulfide bond formation, which are critical for its oligomerization into high-molecular-mass complexes . This structural arrangement resembles the organization of bacteriophage-encoded antiholins, suggesting evolutionary conservation of this protein family across different biological systems.

How is LrgA related to bacteriophage antiholins?

LrgA exhibits structural and functional similarities to bacteriophage-encoded antiholins. Based on secondary-structure analyses, LrgA was proposed to encode an antiholin-like protein with inhibitory effects on murein hydrolase enzymes . Unlike classical phage antiholins that function exclusively during viral reproduction cycles, bacterial LrgA serves physiological roles in controlling endogenous cellular processes. The protein's mechanism of action appears similar to that of phage antiholins, where it prevents the formation of membrane pores, though it has been adapted to regulate normal bacterial physiological processes rather than phage release .

What experimental approaches are typically used to express and purify recombinant LrgA?

Recombinant LrgA can be successfully expressed using systems like pET24b vectors in Escherichia coli strain C43, a derivative of BL21(DE3) that has been specifically selected for optimal overproduction of membrane proteins . The typical methodology involves:

  • PCR amplification of the lrgA gene using forward primers containing an NdeI restriction site and reverse primers with an XhoI site

  • Digestion of PCR products with NdeI and XhoI

  • Insertion of digested products between the NdeI and XhoI sites of the pET24b vector, generating C-terminal His-tag fusions

  • Transformation into E. coli C43 for expression

  • Induction of protein production using IPTG

  • Membrane fraction isolation followed by detergent solubilization

  • Purification using nickel affinity chromatography

This approach accounts for LrgA's membrane localization and helps maintain protein stability during purification processes .

How does LrgA oligomerization affect its function in controlling cell death and lysis?

LrgA oligomerization appears to have a significant regulatory impact on its function. Research shows that LrgA forms high-molecular-mass complexes through disulfide bonds between cysteine residues . When these disulfide bonds are disrupted through mutation, S. aureus exhibits increased cell lysis during stationary phase, suggesting that oligomerization has an inhibitory effect on cell lysis . The oligomerization state likely influences LrgA's ability to interact with and inhibit murein hydrolase activity.

Experimental evidence from S. aureus mutants in which wild-type LrgA was replaced with cysteine mutant alleles showed:

Parameter MeasuredWild-type LrgACysteine Mutant LrgASignificance
Stationary phase cell lysisBaselineIncreasedp<0.01
Biofilm adhesionBaselineEnhancedp<0.05
Dead cell accumulation in biofilmBaselineIncreasedp<0.01

These findings indicate that oligomerization serves as a regulatory mechanism that modulates LrgA's antiholin activity, controlling the timing and extent of cell death during biofilm development .

What is the relationship between LrgA and CidA in the context of bacterial programmed cell death?

LrgA and CidA form a functionally antagonistic pair that regulates bacterial programmed cell death and lysis. CidA exhibits holin-like properties with a positive effect on murein hydrolase activity, while LrgA functions as an antiholin with inhibitory effects on these enzymes . This relationship creates a regulatory circuit that determines cell fate:

  • CidA promotes cell death by facilitating murein hydrolase access to peptidoglycan

  • LrgA counteracts this activity by preventing hydrolase release or activity

  • The balance between these proteins determines whether cells undergo lysis

This CidA/LrgA system represents a bacterial analog to programmed cell death mechanisms in eukaryotes, controlling the dynamics of bacterial populations during biofilm formation and other stress conditions . Current research suggests that the relative expression levels of these proteins, their oligomerization states, and their localization patterns within the membrane collectively determine the life-or-death decision in bacterial cells.

How do contradictory findings about LrgA function get reconciled in current research?

Contradictory findings regarding LrgA function present significant challenges in this research field. Researchers employ several methodological approaches to reconcile these contradictions:

  • Systematic comparison of experimental conditions: Differences in strain backgrounds, growth conditions, and experimental methodologies are carefully documented and compared to identify factors that might explain divergent results .

  • Integration of diverse data types: Researchers combine genetic, biochemical, and microscopy data to build comprehensive models that can account for seemingly contradictory observations .

  • Computational modeling: Mathematical models of LrgA-CidA interactions help identify parameter spaces where apparently contradictory behaviors can be explained within a unified framework.

  • Targeted genetic studies: Specific mutations or domain swaps between LrgA and related proteins help pinpoint functional regions responsible for disparate observations.

For example, contradictory findings regarding LrgA's role in antibiotic tolerance were resolved by recognizing that different antibiotics target distinct cellular processes, and LrgA's effect varies depending on the specific mechanism of antibiotic action and the physiological state of the bacteria .

What fluorescence microscopy techniques are most effective for studying LrgA localization and dynamics?

Advanced fluorescence microscopy techniques provide crucial insights into LrgA localization and dynamics. Based on methodologies applied to similar membrane proteins, the following approaches are particularly effective:

For optimal results, researchers should:

  • Use monomeric fluorescent proteins to minimize artificial aggregation

  • Include transmembrane domain integrity verifications

  • Employ photoconvertible fluorescent proteins to track specific protein populations over time

  • Combine with super-resolution techniques like STORM or PALM for detailed localization studies

What are the most effective methods for studying LrgA-CidA interactions?

Investigating LrgA-CidA interactions requires specialized approaches that account for their membrane localization and potential transient interactions. Effective methodologies include:

  • Co-immunoprecipitation with membrane-specific modifications: Traditional co-IP protocols adapted for membrane proteins using mild detergents like DDM or digitonin to maintain native interactions.

  • Bimolecular Fluorescence Complementation (BiFC): This technique involves creating split fluorescent protein fusions that only produce fluorescence when the two target proteins interact, allowing visualization of interactions in living cells.

  • Förster Resonance Energy Transfer (FRET): By tagging LrgA and CidA with appropriate fluorophore pairs, researchers can detect nanometer-scale proximity indicating protein interaction.

  • Bacterial Two-Hybrid systems adapted for membrane proteins: Modified bacterial two-hybrid approaches specifically designed for membrane proteins can detect interactions in a more native context than traditional yeast two-hybrid systems.

  • Cross-linking followed by mass spectrometry: Chemical cross-linking can capture transient interactions, which are then identified through proteomic analysis.

When designing these experiments, controls must account for the possibility that LrgA-CidA interactions may be regulated by cellular conditions like redox state, membrane potential, or specific growth phases that affect disulfide bond formation .

How can gene expression systems be optimized for controlled production of recombinant LrgA?

Optimizing expression systems for recombinant LrgA requires addressing several challenges related to membrane protein production. Based on successful approaches with similar proteins, researchers should consider:

  • Expression vector selection: For bacterial expression, the pET24b vector has proven effective when combined with E. coli C43, a strain optimized for membrane protein production . For eukaryotic expression, vectors with tunable promoters like the Tet-On system provide better control.

  • Induction parameters optimization:

    • Temperature reduction (typically to 18-25°C) during induction

    • Lowered inducer concentration (e.g., 0.1-0.5 mM IPTG instead of 1 mM)

    • Extended expression times at lower temperatures

  • Fusion partners to enhance stability and folding:

    • Maltose binding protein (MBP)

    • Thioredoxin (TrxA)

    • SUMO tag with subsequent removal via SUMO protease

  • Membrane mimetics for extraction and purification:

    • Detergent screening (DDM, LMNG, CHAPS)

    • Nanodisc incorporation

    • Amphipol stabilization

  • Codon optimization: Adjusting the coding sequence to match the codon usage bias of the expression host without altering critical structural elements.

A systematic approach testing multiple combinations of these parameters using small-scale expression trials prior to scale-up typically yields the best results for challenging membrane proteins like LrgA.

How can researchers resolve contradictory findings in LrgA functional studies?

Resolving contradictory findings in LrgA functional studies requires a systematic approach to data analysis and experimental design:

  • Standardized reporting of experimental conditions: Detailed documentation of strain backgrounds, growth conditions, and methodological parameters enables more effective comparison across studies .

  • Meta-analysis approaches: Using clinical contradiction detection methodologies similar to those developed for medical literature can help identify patterns in conflicting results. These approaches leverage ontology-driven datasets to find potential contradictions and their underlying causes .

  • Statistical reanalysis: When raw data is available, applying consistent statistical methods across studies can reveal whether apparent contradictions stem from different analytical approaches rather than biological differences.

  • Context-dependent functional analyses: Recognizing that LrgA may have different functions depending on growth phase, stress conditions, or genetic background helps reconcile apparently contradictory observations .

  • Experimental reproduction with systematic parameter variation: Reproducing key experiments while systematically varying individual parameters can identify the specific conditions under which different outcomes occur.

This methodical approach has successfully resolved contradictions regarding LrgA's role in biofilm formation, revealing that its impact varies depending on biofilm maturation stage and the specific parameters being measured .

What bioinformatic approaches are most useful for analyzing the evolutionary relationships of LrgA across bacterial species?

Understanding LrgA's evolutionary relationships requires sophisticated bioinformatic approaches tailored to membrane proteins:

  • Profile Hidden Markov Models (HMMs): Unlike basic BLAST searches, HMM profiles capture the position-specific conservation patterns critical for identifying distant LrgA homologs across diverse bacterial phyla.

  • Transmembrane topology prediction integration: Incorporating predictions from tools like TMHMM, TOPCONS, and Phobius into sequence analysis helps identify structural conservation even when sequence similarity is low.

  • Coevolutionary analysis: Methods like Direct Coupling Analysis (DCA) identify coevolving residue pairs, revealing functional constraints and potential interaction surfaces within the protein.

  • Genomic context analysis: Examining the conservation of gene neighborhoods surrounding lrgA provides insights into functional associations and evolutionary trajectories.

  • Phylogenetic analyses with appropriate models: Using evolutionary models specifically designed for membrane proteins, which account for the different selective pressures in transmembrane versus soluble regions.

These approaches have revealed that LrgA belongs to an ancient protein family with representatives across diverse bacterial phyla, suggesting fundamental roles in bacterial physiology beyond the specific functions identified in S. aureus .

What are the current limitations in structural studies of LrgA and how might they be overcome?

Structural characterization of LrgA remains challenging due to several factors inherent to membrane proteins:

  • Current limitations:

    • Difficulty in obtaining sufficient quantities of purified, correctly folded protein

    • Challenges in crystallizing membrane proteins for X-ray crystallography

    • Protein instability outside the native membrane environment

    • Complex oligomerization states dependent on disulfide bonds

  • Emerging solutions:

    • Cryo-electron microscopy (cryo-EM): Recent advances in single-particle cryo-EM have revolutionized membrane protein structural studies, potentially allowing LrgA structure determination without crystallization

    • Integrative structural biology: Combining lower-resolution techniques (SAXS, cross-linking MS) with computational modeling to build composite structural models

    • Native mass spectrometry: Advanced MS methods compatible with membrane proteins can provide insights into oligomeric states and complex composition

    • In situ structural techniques: Methods like electron tomography can visualize LrgA in its native membrane context

  • Computational approaches:

    • AlphaFold2 and RoseTTAFold have shown promise for predicting membrane protein structures

    • Molecular dynamics simulations in realistic membrane environments can provide functional insights even with imperfect structural models

These approaches, particularly when used in combination, offer promising pathways to overcome the current structural biology challenges for LrgA.

How might understanding LrgA function contribute to new antimicrobial strategies?

LrgA's role in controlling cell death and antibiotic tolerance presents several promising avenues for novel antimicrobial development:

  • Targeting the CidA/LrgA balance: Compounds that disrupt the homeostasis between these opposing functions could potentially sensitize bacteria to existing antibiotics or directly promote bacterial cell death .

  • Exploiting disulfide bond formation: Since oligomerization through disulfide bonds appears critical for LrgA function, drugs targeting this process could modulate LrgA activity and bacterial survival .

  • Biofilm disruption strategies: Given LrgA's role in biofilm formation and maturation, inhibitors could potentially disrupt biofilm integrity, making bacterial communities more susceptible to conventional antibiotics .

  • Synthetic biology approaches: Engineered phage expressing modified antiholins could potentially be developed to trigger bacterial lysis on demand.

  • Combination therapy potentiation: Understanding how LrgA affects antibiotic tolerance could lead to adjuvant therapies that enhance the effectiveness of existing antibiotics against resistant strains .

This research direction holds particular promise for addressing Staphylococcus aureus infections, especially those involving biofilms and antibiotic-resistant strains, where conventional antimicrobial approaches often fail.

What new methodological approaches might advance our understanding of LrgA dynamics in living cells?

Emerging technologies offer exciting possibilities for studying LrgA dynamics in living bacterial cells with unprecedented detail:

  • Super-resolution microscopy techniques:

    • PALM/STORM imaging can resolve LrgA distribution patterns below the diffraction limit

    • Lattice light-sheet microscopy enables long-term 3D imaging with minimal phototoxicity

    • Expansion microscopy physically enlarges samples to achieve super-resolution with conventional microscopes

  • Advanced fluorescent tagging strategies:

    • Split fluorescent proteins allow visualization of protein topology

    • Photoconvertible fluorescent proteins enable pulse-chase analysis of protein populations

    • HaloTag and SNAP-tag technologies permit flexible labeling with diverse fluorophores

  • Live-cell single-molecule tracking:

    • Single-particle tracking approaches can follow individual LrgA molecules in living cells

    • Techniques like sptPALM combine single-molecule localization and tracking

    • These approaches can directly measure diffusion rates, confinement, and molecular interactions

  • Correlative light and electron microscopy (CLEM):

    • Combines the molecular specificity of fluorescence with the ultrastructural detail of EM

    • Could reveal LrgA's relationship to membrane microdomains and other cellular structures

  • Optogenetic control of LrgA function:

    • Light-inducible dimerization domains could be used to control LrgA oligomerization

    • This would enable precise temporal control over LrgA function in living cells

These emerging methodologies promise to transform our understanding of how LrgA functions within the complex and dynamic environment of living bacterial cells .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.