Recombinant Antiholin-like protein LrgB (lrgB)

Shipped with Ice Packs
In Stock
Cat. No.
BT2123812
Source
in vitro E.coli expression system
Synonyms
lrgB; BA_5689; GBAA_5689; BAS5293; Antiholin-like protein LrgB
Quick Inquiry

Description

Regulation of Cell Lysis

LrgB inhibits holin-mediated cell lysis by stabilizing membrane integrity:

  • Overexpression of lrgAB suppresses autolysis in Bacillus subtilis, while deletion increases cell death during sporulation .

  • In S. aureus, LrgB forms complexes with LrgA to block holin-like CidA activity, reducing murein hydrolase activation .

Biofilm Development

LrgB modulates biofilm formation by controlling extracellular DNA (eDNA) release:

  • lrgB inactivation in S. aureus increases biofilm accumulation due to enhanced cell lysis and eDNA deposition .

  • Strains lacking lrgB exhibit 2–3× higher biofilm biomass compared to wild-type .

Metabolic Interactions

Recent studies suggest LrgB participates in metabolite transport:

  • lrgAB mutants in S. aureus show impaired pyruvate uptake under anaerobic conditions, linking antiholin activity to metabolic regulation .

  • Homologues in plant chloroplasts and Bacillus spp. suggest conserved roles in stress response and energy metabolism .

Genetic and Phenotypic Studies

Study ModelFindingsSource
Bacillus subtilis ΔcdsRCdsR represses lrgAB; overexpression causes cell lysis via holin-endolysin (LrgAB-CwlD) synergy .
S. aureus ΔlrgBIncreased autolysis rates (50–60% cell death vs. 17% in wild-type) and biofilm adherence .
S. aureus complemented strainslrgB restoration reduces biofilm biomass by 40–50% .

Mechanistic Insights

  • Holin-Antiholin Dynamics: LrgB binds LrgA to prevent pore formation, analogous to phage antiholins .

  • Membrane Localization: Fluorescent fusion tags confirm LrgB localizes to the cytoplasmic membrane .

  • Disulfide-Dependent Oligomerization: Cysteine residues in LrgB are critical for functional complex assembly .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
lrgB; BA_5689; GBAA_5689; BAS5293; Antiholin-like protein LrgB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
lrgB
Target Protein Sequence
MASTMTPYFGIVVSLIAYGIGTLLFKHSKGFFLFTPLFVAMVLGIVFLKVGNFTFEEYNT GGKMISFFLEPATIAFAIPLYKQVDKLKKYWWQILSAIVVGSICSVIVVFIVAKAIGLDT AVMNSMLPQAATTAIALPISESIGGIPAITSFAVIFNAVIVYALGALFLKTFRVKHPIAK GLALGTAGHALGVAVGIEMGEVEAAMASIAVTVVGVVTVVVIPMFMPFIG
Uniprot No.
Q81JL5

Target Background

Function

Recombinant Antiholin-like protein LrgB (lrgB) inhibits the expression or activity of extracellular murein hydrolases. This inhibition is achieved through interaction, possibly with LrgA, and the holin-like protein CidA. The LrgAB and CidA proteins may influence the membrane's proton motive force. LrgB may also be involved in programmed cell death (PCD), potentially triggering PCD in response to antibiotic exposure and environmental stressors.

Database Links

KEGG: ban:BA_5689

STRING: 260799.BAS5293

Protein Families
CidB/LrgB family, LrgB subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.