Recombinant Antirrhinum majus Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

  • Expression System: Optimized codon usage in E. coli ensures high yield .

  • Purification: Affinity chromatography via His tag, followed by buffer exchange into Tris/PBS with 6% trehalose (pH 8.0) .

  • Formulation: Lyophilized powder for long-term stability; reconstitution in sterile water (0.1–1.0 mg/mL) with 50% glycerol recommended .

Role in Photosystem II Assembly

  • psbD forms a heterodimer with D1, constituting the PSII reaction center (RC). This dimer binds chlorophyll, pheophytin, and quinones for electron transport .

  • In vascular plants, psbD synthesis is not rate-limiting for PSII biogenesis, unlike in algae (e.g., Chlamydomonas reinhardtii) .

Assembly Factors and Interactions

FactorFunctionOrganism
Ycf48Stabilizes D1/D2 during RC assemblyCyanobacteria
Psb34Facilitates CP43 antenna attachment to RC47Cyanobacteria
PTF1Binds psbD promoter to regulate transcriptionArabidopsis
  • Cryo-EM studies reveal psbD’s structural flexibility during CP43 module integration into PSII .

Regulatory Mechanisms

  • Transcriptional Control: The nuclear-encoded PTF1 protein binds the ACC repeat in the psbD promoter, enhancing mRNA accumulation under light . Mutants lacking PTF1 show reduced psbD transcription and impaired growth .

  • Translational Control: In plastids, psbD translation initiation depends on mRNA secondary structure remodeling, mediated by RBP40 and Nac2 in algae .

Research Applications

  • Structural Biology: Used in cryo-EM studies to resolve PSII assembly intermediates .

  • Enzyme Activity Assays: Catalyzes water oxidation (EC 1.10.3.9); applied in photosynthetic mechanism studies .

  • Protein-Protein Interaction Studies: His-tagged psbD enables pulldown assays to identify assembly factors like Ycf48 and Psb34 .

Limitations and Considerations

  • Instability: Repeated freeze-thaw cycles degrade the protein .

  • Non-Human Use: Not intended for therapeutic or diagnostic applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: Our proteins are routinely shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Antirrhinum majus (Garden snapdragon)
Target Names
psbD
Target Protein Sequence
MTIALGKFTKDENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFAVGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors. D2 is crucial for the assembly of a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem II D2 protein and what role does it play in Antirrhinum majus?

The D2 protein is a core component of the Photosystem II (PSII) reaction center in plants, including Antirrhinum majus (snapdragon). Along with the D1 protein, it forms the heterodimeric core of PSII where the primary photochemical reactions of oxygenic photosynthesis take place. The D2 protein is encoded by the chloroplast psbD gene and is essential for the assembly and function of PSII. In Antirrhinum majus, as in other plants, the D2 protein plays a crucial role in electron transport during photosynthesis, being involved in water oxidation and plastoquinone reduction processes. The protein contains binding sites for cofactors involved in electron transfer and is particularly vulnerable to photodamage, necessitating regular turnover and replacement within the photosynthetic apparatus.

How does the psbD gene expression differ between Antirrhinum majus and other model organisms?

The psbD gene in plants including Antirrhinum majus is subject to light-dependent regulation, which shows both similarities and differences compared to other model organisms. While the basic function of encoding the D2 protein is conserved across photosynthetic organisms, regulatory mechanisms can differ:

The psbD gene in higher plants contains a conserved Light-Responsive Promoter that is activated by blue and UV-A light, which helps compensate for the photo-induced degradation of the D2 protein that is particularly sensitive to these wavelengths.

What are the most effective expression systems for producing recombinant Antirrhinum majus D2 protein?

For successful expression of recombinant Antirrhinum majus D2 protein, researchers should consider the following methodological approaches:

  • Chloroplast Transformation Systems: Since the psbD gene is naturally located in the chloroplast genome, homologous chloroplast transformation in tobacco or other model plants can be effective. This approach maintains the protein in its native environment with appropriate post-translational modifications and assembly partners.

  • Bacterial Expression Systems: For biochemical studies requiring larger protein quantities:

    • E. coli-based systems with specialized vectors containing chloroplast-specific regulatory elements

    • Expression as fusion proteins with solubility-enhancing tags (MBP, SUMO, etc.)

    • Codon optimization based on Antirrhinum majus chloroplast codon usage patterns

    • Growth at lower temperatures (15-20°C) to reduce inclusion body formation

  • Cell-Free Expression Systems: These can be particularly useful for membrane proteins like D2, allowing for immediate incorporation into liposomes or nanodiscs.

When selecting an expression system, researchers should consider the experimental objectives (structural studies, functional assays, etc.) and required protein yield and purity. In all cases, maintaining the proper folding and functionality of this membrane-associated protein remains a significant challenge.

What purification strategies overcome the hydrophobic nature of the D2 protein?

Purifying recombinant D2 protein presents challenges due to its hydrophobic nature and membrane association. Effective methodological approaches include:

  • Detergent Selection: Systematic testing of detergents is crucial, with mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin often providing the best balance between protein solubilization and native structure preservation.

  • Two-Phase Extraction:

    • Initial extraction using a stronger detergent (e.g., SDS or Triton X-100)

    • Subsequent exchange to a milder detergent during chromatography

  • Chromatography Sequence:

    • Immobilized metal affinity chromatography (IMAC) using engineered His-tags

    • Size exclusion chromatography to separate properly folded protein from aggregates

    • Ion exchange chromatography for final polishing

  • Alternative Approaches:

    • Amphipol-based purification for improved stability

    • Nanodiscs or liposomes for reconstitution studies

    • Styrene maleic acid lipid particles (SMALPs) for extraction with surrounding lipids

For functional studies, researchers should confirm protein activity post-purification using spectroscopic methods to verify chlorophyll binding and electron transport capability.

How do oxidative modifications affect the structure and function of the D2 protein?

Oxidative modifications significantly impact D2 protein structure and function, particularly under photoinhibitory conditions. Research findings reveal:

Oxidation SiteProximityConsequenceTimeline of Modification
D2:244YBicarbonate ligand for nonheme ironInitiates oxidative cascade in D-de loop of D2 proteinOccurs after extended illumination
D2:328W, 333D, 334Q, 336HWithin 32Å of Mn₄O₅Ca clusterEarly indicators of oxidative damage on luminal sideObservable within 15 min of photoinhibition
D2:242E, 245SNear nonheme iron and QAAffects electron transfer from QAOccurs after 30 min of illumination
D2:341F, 342P, 343E, 344E, 345VLuminal side near Mn₄O₅Ca clusterLikely impacts water oxidationLater-stage modifications

These oxidative modifications occur through several mechanisms:

  • Hydrogen atom abstraction by hydroxyl radicals (HO- ) forming protein radicals (P- )

  • Reaction with oxygen to generate peroxyl radicals (POO- )

  • Subsequent reduction to protein hydroperoxides (POOH)

The proximity of these modifications to critical functional elements of PSII (manganese cluster, nonheme iron, electron acceptors) directly correlates with impaired photosynthetic function. Over time, these modifications lead to structural changes that inhibit electron transfer and ultimately necessitate D2 protein replacement through the PSII repair cycle.

What techniques are most reliable for assessing D2 protein turnover rates in Antirrhinum majus?

Researchers investigating D2 protein turnover in Antirrhinum majus should consider these methodological approaches:

  • Pulse-Chase Radiolabeling:

    • Incorporation of ³⁵S-methionine followed by immunoprecipitation

    • Data analysis using first-order kinetics to determine half-life

    • Comparison between light and dark conditions (studies in other systems show 2.7-fold increased D2 synthesis rates in light)

  • Fluorescent Protein Fusions:

    • C-terminal fusions with photoconvertible fluorescent proteins

    • Time-lapse microscopy to track protein degradation

    • Quantification through fluorescence decay curves

  • Quantitative Mass Spectrometry:

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or ¹⁵N-labeling approaches

    • Targeted Multiple Reaction Monitoring (MRM) for specific D2 peptides

    • Data analysis using exponential decay models

  • Inhibitor-Based Approaches:

    • Use of lincomycin to inhibit chloroplast translation

    • Western blot quantification of D2 protein at time intervals

    • Calculation of degradation rates under various light conditions

When comparing results across methods, researchers should account for differential sensitivity and potential artifacts introduced by each technique. Combining multiple approaches provides the most reliable assessment of D2 turnover dynamics, particularly when investigating environmental or genetic effects on this process.

How should experiments be designed to study light-dependent regulation of psbD expression in Antirrhinum majus?

A comprehensive experimental design for studying light-dependent regulation of psbD expression in Antirrhinum majus should incorporate the following methodological elements:

  • Light Treatment Parameters:

    • Controlled light regimes with specific wavelengths (particularly blue and UV-A)

    • Varying light intensities (50-1000 μmol photons m⁻² s⁻¹)

    • Different durations of illumination (ranging from 15 minutes to several days)

    • Dark-to-light transitions with sampling at multiple time points (0, 15, 30, 60, 120 minutes)

  • Tissue Selection and Growth Conditions:

    • Use of both young seedlings and mature leaves

    • Standardized growth conditions prior to experiments

    • Comparison across different tissue types (leaves, stems, flowers)

  • Molecular Analysis Techniques:

    • Quantitative RT-PCR for psbD mRNA levels

    • RNA gel-blot analysis for tissue-specific expression patterns

    • S1 protection assays for transcription start site mapping

    • Chromatin immunoprecipitation (ChIP) for regulatory protein binding

    • In vitro transcription assays with isolated chloroplasts

  • Protein Analysis Techniques:

    • Western blotting for D2 protein accumulation

    • Pulse-labeling experiments to measure D2 synthesis rates

    • Redox state analysis using 2D redox SDS-PAGE

  • Controls and Variables:

    • Wild-type vs. mutant comparisons

    • Photosynthetic inhibitor treatments

    • Redox modifier applications

    • Temperature variations

The experimental design should include appropriate statistical analysis, with at least three biological replicates and appropriate normalization to control genes or proteins.

What is the relationship between D2 protein oxidation and photoinhibition pathways?

The relationship between D2 protein oxidation and photoinhibition follows complex pathways with bidirectional causality. Current research findings indicate:

  • Reactive Oxygen Species (ROS) Formation Sites:

    • Hydroxyl radicals (HO- ) form at both the Mn₄O₅Ca cluster and the nonheme iron

    • Superoxide (O₂- −) forms at either pheophytin (Pheo) or the primary quinone acceptor (QA)

  • Oxidation Cascade Progression:

    • Initial oxidation occurs at D2:244Y (bicarbonate ligand for nonheme iron)

    • This triggers propagation of oxidative reactions in the D-de loop of D2

    • D2:242E and D2:245S near the nonheme iron and QA become modified after longer exposure

    • Luminal-side residues (D2:341F, 342P, 343E, 344E, 345V) near the Mn₄O₅Ca cluster show later modification

  • Functional Consequences:

    • Oxidation of stromal-side residues impairs electron transfer from QA

    • Modification of luminal-side residues compromises water oxidation

    • Cumulative oxidative damage correlates with declining oxygen evolution capacity

    • 45% loss of oxygen evolution coincides with specific oxidative modifications

  • Protection and Repair Mechanisms:

    • Light-activated psbD expression compensates for D2 damage

    • This regulatory mechanism specifically responds to blue and UV-A light, which cause the most D2 damage

    • The balance between damage and repair determines net photoinhibition

This relationship creates a feedback loop where initial photoinhibition generates ROS that cause further protein oxidation, accelerating photodamage unless repair mechanisms can compensate.

How can researchers distinguish between light-induced and developmental regulation of psbD in Antirrhinum majus?

Distinguishing between light-induced and developmental regulation of psbD requires careful experimental design and multiple analytical approaches:

  • Temporal Analysis:

    • Short-term light responses (minutes to hours) typically reflect direct light regulation

    • Longer-term changes (days) may represent developmental programming

    • Time-course experiments with frequent sampling can help separate these effects

  • Tissue-Specific Expression Analysis:

    • Compare expression patterns across developmental stages while controlling light conditions

    • Examine tissue-specific expression (leaves, stems, flowers, roots)

    • RNA gel-blot analysis reveals highest psbD LRP expression in leaves, correlating with photosynthetic capacity rather than just light exposure

  • Spectral Quality Experiments:

    • Test responses to specific wavelengths (especially blue and UV-A light)

    • Pure developmental regulation would show less wavelength specificity

    • Light-induced regulation shows distinct blue/UV-A light sensitivity

  • Promoter Analysis:

    • Use of reporter gene constructs with different promoter regions

    • Identification of light-responsive elements vs. developmental control elements

    • Mutational analysis of specific promoter regions

  • Genetic Approaches:

    • Analysis of photoreceptor mutants (cryptochromes, phototropins)

    • Examination of developmental mutants with normal photoreceptors

    • Cross-comparison of results to isolate specific regulatory pathways

When interpreting results, researchers should consider that some regulatory elements may serve dual functions in both light and developmental regulation, requiring careful statistical analysis to deconvolute these effects.

What are the common pitfalls in experimental design when studying D2 protein oxidation patterns?

Researchers studying D2 protein oxidation patterns should be aware of these common methodological pitfalls:

  • Sample Preparation Artifacts:

    • Artificial oxidation during extraction (use anaerobic conditions and antioxidants)

    • Incomplete protein recovery (especially of heavily modified proteins)

    • Temperature-dependent changes in oxidation patterns during processing

  • Temporal Resolution Limitations:

    • Insufficient time points to capture oxidation progression

    • Sampling intervals that miss critical transition periods

    • Failure to distinguish between primary and secondary oxidation events

  • Light Treatment Variables:

    • Inconsistent light quality and quantity across experiments

    • Inadequate dark controls or dark adaptation periods

    • Failure to monitor and report photon flux density accurately

  • Mass Spectrometry Challenges:

    • Under-detection of hydrophobic peptides

    • Selective loss of oxidized peptides during sample preparation

    • Insufficient statistical power for identification of all modified residues

    • Incomplete database entries for plant-specific modifications

  • Data Interpretation Issues:

    • Misattribution of cause and effect in oxidation cascades

    • Failure to distinguish between physiologically relevant modifications and extraction artifacts

    • Over-interpretation of correlative data without mechanistic validation

To overcome these pitfalls, researchers should implement multiple controls, use complementary analytical techniques, and ensure sufficient biological and technical replication. For mass spectrometry studies, specific attention to sample preparation under reducing conditions, use of heavy isotope standards, and application of appropriate statistical models are essential.

How does the redox signaling network integrate with psbD expression in response to oxidative stress?

The integration of redox signaling with psbD expression represents a sophisticated regulatory network that connects photosynthetic electron transport, reactive oxygen species, and gene expression. Advanced research findings indicate:

These mechanisms collectively form an elegant regulatory system linking environmental conditions, metabolic state, and gene expression to maintain photosynthetic function under variable conditions.

What are the evolutionary implications of species-specific differences in D2 protein oxidation resistance mechanisms?

The evolution of D2 protein oxidation resistance mechanisms across species reveals important adaptive strategies and evolutionary constraints in photosynthetic organisms:

  • Comparative Protein Structure Analysis:

    • Despite the core D2 function being conserved across photosynthetic organisms, specific amino acid substitutions at key positions reflect evolutionary adaptations

    • Species adapted to high light environments show enhanced protection of vulnerable residues

    • Antirrhinum majus, like other angiosperms, shares the core D2 structure with modifications reflecting its specific ecological niche

  • Regulatory Mechanism Divergence:

    • Algae like Chlamydomonas employ disulfide-based light switches for psbD regulation

    • Higher plants including Arabidopsis utilize nuclear-encoded basic helix-loop-helix proteins interacting with the psbD Light-Responsive Promoter

    • These different approaches to regulation reflect evolutionary solutions to the same challenge of photoinhibition

  • Repair vs. Prevention Strategies:

    • Some species prioritize rapid D2 turnover (repair-dominant strategy)

    • Others invest in protective mechanisms to prevent oxidative damage (prevention-dominant strategy)

    • The balance between these strategies correlates with ecological factors including light environment, temperature regimes, and water availability

  • Functional Constraints and Evolutionary Flexibility:

    • The core electron transfer function imposes strict constraints on D2 structure

    • Greater evolutionary flexibility exists in regulatory mechanisms than in the protein itself

    • This pattern exemplifies a common evolutionary principle: conserved function with diverse regulatory adaptations

Understanding these evolutionary patterns not only illuminates photosynthesis evolution but also provides insights for engineering photosynthetic efficiency in crops and designing artificial photosynthetic systems based on naturally evolved solutions to oxidative stress management.

What are the most promising research directions for improving recombinant D2 protein stability and functionality?

Future research on improving recombinant Antirrhinum majus D2 protein stability and functionality should focus on these promising directions:

  • Structure-Guided Protein Engineering:

    • Introduction of stabilizing mutations at oxidation-sensitive residues

    • Redesign of interfaces between D2 and other PSII components

    • Application of computational design methods to identify stabilizing modifications

    • Development of chimeric proteins incorporating resistant features from extremophile organisms

  • Expression System Optimization:

    • Design of specialized chloroplast expression vectors with enhanced stability elements

    • Development of chaperone co-expression strategies for improved folding

    • Creation of inducible expression systems with fine-tuned control

    • Engineering of host cell redox environments to minimize oxidative damage during expression

  • Novel Purification and Stabilization Methods:

    • Application of nanodiscs and advanced membrane mimetics

    • Development of affinity tags specifically designed for membrane proteins

    • Use of novel amphipathic polymers for membrane protein stabilization

    • Implementation of automation for rapid purification under anoxic conditions

  • Advanced Analytical Approaches:

    • Cryo-electron microscopy for structure determination in near-native states

    • Time-resolved spectroscopy to capture dynamic aspects of function

    • Native mass spectrometry for intact complex analysis

    • Single-molecule techniques to examine heterogeneity in protein behavior

These approaches, particularly when used in combination, offer significant potential for advancing our understanding of D2 protein structure-function relationships and developing more stable recombinant versions for research and biotechnological applications.

How might understanding D2 protein regulation contribute to improving crop photosynthetic efficiency under stress conditions?

Understanding D2 protein regulation offers several translational pathways to enhance crop photosynthetic efficiency under stress conditions:

  • Targeted Genetic Modifications:

    • Engineering of psbD promoter regions to enhance light-responsive expression

    • Introduction of optimized regulatory elements from stress-tolerant species

    • Development of synthetic regulatory circuits for conditional expression under stress

    • Fine-tuning of D2 turnover rates to match environmental challenges

  • Enhanced Photoinhibition Resistance:

    • Modification of key oxidation-sensitive residues identified in research

    • Engineering of non-photochemical quenching mechanisms to prevent excess excitation

    • Introduction of enhanced ROS scavenging systems targeted to Photosystem II

    • Optimization of the D2 repair cycle for faster recovery from photodamage

  • Stress-Specific Adaptation Strategies:

    • Development of drought-specific D2 regulatory mechanisms

    • Engineering temperature-responsive expression systems

    • Creation of salt-tolerant D2 variants with modified ion interactions

    • Design of UV-resistant D2 proteins for high-altitude cultivation

  • Integrative Approaches:

    • Coordinated engineering of both D1 and D2 proteins for balanced photosystem function

    • Holistic modification of the entire PSII repair cycle rather than single components

    • Systems biology approaches to predict emergent properties of modified regulatory networks

    • Field validation of laboratory findings under real-world stress conditions

Translating these approaches to crops requires consideration of species-specific factors, regulatory approval pathways, and potential ecological impacts. Nevertheless, the fundamental understanding of D2 protein regulation provides a scientifically sound foundation for rational engineering of more resilient photosynthetic systems in crops facing climate change challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.