Recombinant Aotus nigriceps Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, please specify any format requirements in your order notes, and we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Aotus nigriceps (Black-headed night monkey)
Target Names
Target Protein Sequence
MATPAQLGLQNATSPIMEELIAFHDHALMIIFLISSLVLYIISLMLTTKLTHTSTMNAQE IEMIWTILPAIILIMIALPSLRILYMTDEFNKPYLTLKAIGHQWYWSYEYSDYEDLAFDS YITPTYFLEPGEFRLLEVDNRTTLPMEADIRMLITSQDVLHSWAVPSLGVKTDAIPGRLN QAMLASMRPGLFYGQCSEICGSNHSFMPIVLEFIYFQDFEVWASYLYIVSL
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work in concert to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1. The BNC, consisting of heme A3 and copper B (CuB), reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO2 and what is its role in Aotus nigriceps?

MT-CO2 (mitochondrially encoded cytochrome c oxidase II) is a critical protein-coding gene located in the mitochondrial genome of Aotus nigriceps (black-headed night monkey). It encodes subunit II of cytochrome c oxidase (CcO), which forms an essential component of the respiratory chain complex IV in the mitochondrial inner membrane. This protein contributes to cytochrome c oxidase activity and plays a crucial role in the mitochondrial electron transport process, transferring electrons from cytochrome c to oxygen while simultaneously pumping protons across the inner mitochondrial membrane to generate the electrochemical gradient necessary for ATP synthesis . In Aotus nigriceps, as in other primates, MT-CO2 serves as a valuable marker for evolutionary and phylogenetic studies due to its conserved functional domains and variable regions that accumulate mutations at rates useful for species identification .

How does MT-CO2 from Aotus nigriceps differ from other primate species?

The MT-CO2 gene in Aotus nigriceps shows distinctive nucleotide variations that differentiate it from other primate species, including closely related owl monkeys. Sequence analysis has revealed species-specific polymorphisms that serve as molecular signatures for accurate taxonomic classification . When compared with other Aotus species like A. vociferans and A. nancymaae, A. nigriceps MT-CO2 exhibits characteristic nucleotide substitutions that have accumulated since their evolutionary divergence approximately 4.62 million years before present . These sequence variations, while maintaining the protein's essential functional domains, occur primarily in third codon positions and less constrained regions, resulting in a pattern of genetic distance that reflects the evolutionary relationships among owl monkey species. Notably, phylogenetic analysis utilizing MT-CO2 sequences has helped clarify taxonomic uncertainties, as some GenBank specimens initially identified as other species have been reclassified based on their MT-CO2 sequence alignment, such as the specimen DQ321664 originally labeled as A. nigriceps but later identified as A. trivirgatus .

What is the genomic structure of MT-CO2 in Aotus nigriceps?

The MT-CO2 gene in Aotus nigriceps, like in other mammals, is located in the mitochondrial genome. The gene lacks introns, which is characteristic of mitochondrial genes . Based on comparative analysis with human MT-CO2 (which spans positions 7586-8269 on the mitochondrial chromosome), the Aotus nigriceps MT-CO2 gene has a similar size of approximately 684 base pairs, encoding a protein of about 227 amino acids . The gene contains highly conserved regions critical for protein function, particularly those encoding amino acid residues involved in copper binding and electron transfer. These functional domains show higher sequence conservation across species compared to other regions of the gene. The complete MT-CO2 region has been successfully sequenced in Aotus specimens, providing valuable data for phylogenetic analyses and species identification .

What are the optimal methods for extracting and amplifying MT-CO2 DNA from Aotus nigriceps samples?

For optimal extraction and amplification of MT-CO2 DNA from Aotus nigriceps samples, a comprehensive protocol combining tissue preservation, DNA isolation, and PCR amplification is recommended. Begin with fresh tissue samples (blood, muscle, or hair follicles) preserved in 95% ethanol or stored at -80°C to prevent DNA degradation. Extract total genomic DNA using a specialized mammalian DNA isolation kit with modifications for primate samples. For MT-CO2 amplification, design primers targeting conserved regions flanking the MT-CO2 gene based on aligned sequences from multiple Aotus species .

The PCR reaction mixture should contain: 10-50 ng of template DNA, 0.5 μM of each primer, 200 μM dNTPs, 1.5 mM MgCl₂, 1X PCR buffer, and 1-2 units of high-fidelity DNA polymerase in a 50 μl reaction volume. The recommended thermal cycling profile includes: initial denaturation at 94°C for 3 minutes; 35 cycles of denaturation (94°C for 30 seconds), annealing (55-58°C for 45 seconds), and extension (72°C for 1 minute); followed by a final extension at 72°C for 10 minutes. This approach has successfully generated 696 bp amplicons of MT-CO2 from Aotus specimens for phylogenetic analysis . Purify PCR products using silica column-based methods before proceeding to sequencing or cloning procedures.

How can researchers ensure the authenticity of Aotus nigriceps MT-CO2 sequences?

Ensuring the authenticity of Aotus nigriceps MT-CO2 sequences requires multiple validation strategies. First, implement bidirectional Sanger sequencing with high-quality trace scores (Phred quality scores >30) to minimize sequencing errors. This should be followed by careful sequence analysis using specialized software to identify and filter out potential nuclear mitochondrial DNA segments (NUMTs) that could be mistakenly amplified alongside genuine mitochondrial sequences .

Researchers should conduct comparative analyses with existing verified sequences by aligning the obtained MT-CO2 sequence with confirmed A. nigriceps sequences in GenBank. Authentic sequences will cluster phylogenetically with other A. nigriceps samples and show expected genetic distances from related species. For example, validated A. nigriceps MT-CO2 sequences should show greater similarity to each other (typically >98% identity) than to other Aotus species . Additionally, researchers should examine the translated protein sequence for unexpected stop codons or frameshift mutations that might indicate NUMTs or sequencing errors. The detection of appropriate open reading frames and conserved functional domains characteristic of cytochrome c oxidase subunit II provides further validation of sequence authenticity.

What expression systems are most effective for producing recombinant Aotus nigriceps MT-CO2?

For the expression of recombinant Aotus nigriceps MT-CO2, bacterial systems using E. coli have demonstrated effectiveness, particularly when employing fusion protein strategies. A recommended approach utilizes the pMAL or pET expression systems with maltose-binding protein (MBP) tags, which has successfully produced functional recombinant cytochrome c oxidase components that retain their ability to integrate into purified cytochrome c oxidase complexes . When designing the expression construct, codon optimization for E. coli is essential due to the different codon usage between primate mitochondrial and bacterial genomes.

For higher expression yields and proper folding, consider these parameters: (1) Induction with 0.5 mM IPTG at reduced temperatures (16-20°C); (2) Supplementation with copper ions (100 μM CuSO₄) to facilitate proper metal cofactor incorporation; (3) Inclusion of chaperone co-expression plasmids to enhance proper protein folding . Recombinant MT-CO2 can be purified using affinity chromatography, with particular attention to detergent selection for membrane protein solubilization—n-dodecyl β-D-maltoside (DDM) at 1% concentration has shown efficacy in maintaining protein structure while providing sufficient solubilization. The purified protein can be validated through Western blotting using anti-MT-CO2 antibodies and functional assessment through in vitro association with purified cytochrome c oxidase complexes .

How has MT-CO2 contributed to understanding Aotus nigriceps phylogeny?

MT-CO2 sequences have been instrumental in resolving the phylogenetic relationships among Aotus species, including A. nigriceps. Analysis of MT-CO2 sequences, alongside other mitochondrial genes, has challenged conventional views of Aotus diversification that previously divided the genus into monophyletic groups with gray and red necks . Phylogenetic reconstructions using maximum likelihood and Bayesian methods applied to MT-CO2 data have positioned A. nigriceps within a broader evolutionary framework, suggesting divergence events that occurred approximately 4.62 million years before present .

The genetic distance calculations and haplotype differences derived from MT-CO2 sequences have provided critical evidence for species validation and identification of misclassified specimens. For instance, sequence analysis revealed that some GenBank specimens initially classified as other species were actually A. nigriceps, while some labeled as A. nigriceps were reclassified as A. trivirgatus based on their MT-CO2 sequence patterns . This molecular evidence, when integrated with karyotypic and biogeographic data, has enabled researchers to propose alternative evolutionary scenarios for Aotus diversification, contributing significantly to our understanding of how ecological and geographical factors influenced speciation events in these primates.

What are the key genetic markers in MT-CO2 that distinguish Aotus nigriceps from closely related species?

The MT-CO2 gene contains several diagnostic nucleotide positions that serve as key genetic markers for distinguishing Aotus nigriceps from closely related species. These species-specific markers are distributed throughout the 696 base pair region of MT-CO2 and include characteristic single nucleotide polymorphisms (SNPs) that, collectively, create a distinctive genetic signature . While the exact positions are not explicitly detailed in the search results, comparative analysis of sequenced specimens has enabled the confirmation of species identification based on these genetic markers.

The genetic distances calculated from MT-CO2 sequences show that A. nigriceps maintains consistent genetic separation from other Aotus species, such as A. vociferans and A. nancymaae. These distinctions are particularly evident in the analysis of published GenBank sequences, where specimens DQ321664 (originally labeled as A. nigriceps) were reclassified as A. trivirgatus based on MT-CO2 sequence alignment . This suggests that the mutation patterns in MT-CO2 are sufficiently distinct to serve as reliable taxonomic indicators. When combined with other mitochondrial markers like MT-CO1, MT-TS1, MT-TD, and MT-CYB, these genetic signatures provide robust evidence for species boundaries within the Aotus genus, supporting the validation of A. nigriceps as a distinct evolutionary lineage .

How do evolutionary rates of MT-CO2 in Aotus nigriceps compare with other primates?

The evolutionary rates of MT-CO2 in Aotus nigriceps and other owl monkeys reflect a pattern consistent with their phylogenetic position within the primate order. Analysis of molecular clock data suggests that the diversification of Aotus species, including A. nigriceps, began approximately 4.62 million years before present, which corresponds to a moderate evolutionary rate compared to other primate lineages . This rate is sufficient to accumulate diagnostic mutations for species discrimination while maintaining the gene's essential function in the respiratory chain.

Within the Aotus genus, the rate of MT-CO2 evolution has produced enough sequence variation to distinguish between species but shows relative conservation of functionally critical domains. The pattern of nucleotide substitutions in MT-CO2 follows expectations for mitochondrial genes, with higher rates of synonymous than non-synonymous substitutions, particularly in regions encoding functional domains involved in electron transport and copper binding. When compared with other New World primates, Aotus shows distinctive evolutionary patterns that reflect their nocturnal adaptation and geographical distribution across Central and South America . These evolutionary rates have proven valuable for phylogenetic reconstruction, allowing researchers to estimate divergence times and evolutionary relationships that align with other biological evidence, such as karyotypic variations and biogeographic distributions.

How can recombinant Aotus nigriceps MT-CO2 be used to study respiratory chain disorders?

Recombinant Aotus nigriceps MT-CO2 offers a valuable research tool for investigating respiratory chain disorders through comparative structural and functional analyses. Researchers can engineer chimeric cytochrome c oxidase complexes by integrating recombinant A. nigriceps MT-CO2 with human cytochrome c oxidase components to study species-specific differences in electron transfer efficiency and response to metabolic stressors . This approach allows for the isolation of subunit-specific effects and identification of critical residues that influence enzyme function.

For investigating disease-associated mutations, site-directed mutagenesis can be performed on recombinant A. nigriceps MT-CO2 to introduce variants analogous to those found in human mitochondrial disorders like MELAS syndrome . The functional consequences can then be assessed through in vitro enzyme activity assays measuring electron transfer rates, oxygen consumption, and proton pumping efficiency. These analyses provide insights into how specific amino acid substitutions affect cytochrome c oxidase function. Additionally, incorporating recombinant MT-CO2 into liposomal systems or purified bovine heart cytochrome c oxidase complexes allows for detailed spectroscopic analyses using resonance Raman spectroscopy, which can detect subtle conformational changes in the heme structures that might contribute to pathological states .

What bioinformatic approaches are most effective for analyzing MT-CO2 sequence variations across Aotus populations?

For analyzing MT-CO2 sequence variations across Aotus populations, a multi-tiered bioinformatic approach combining phylogenetic, population genetic, and structural analyses yields the most comprehensive results. Begin with multiple sequence alignment using MUSCLE or MAFFT algorithms optimized for coding sequences, followed by maximum likelihood and Bayesian inference methods implemented in tools like MEGA, RAxML, or MrBayes to construct robust phylogenetic trees .

Population genetic analyses should employ DnaSP or Arlequin software to calculate nucleotide diversity (π), haplotype diversity (Hd), and population differentiation statistics (FST). These measures help quantify genetic diversity within and between Aotus populations. Researchers should also implement tests for selection such as dN/dS ratios, McDonald-Kreitman tests, and Tajima's D to identify regions under purifying or positive selection .

For understanding the functional implications of sequence variations, homology modeling using Swiss-Model or Phyre2 can predict structural changes in the protein based on crystal structures of mammalian cytochrome c oxidase. These models allow visualization of how population-specific amino acid substitutions might affect interactions with other subunits or functional domains. Integration of these bioinformatic approaches has successfully differentiated Aotus species and identified misclassified specimens in GenBank datasets, demonstrating their effectiveness for detailed evolutionary analysis of MT-CO2 across owl monkey populations .

How can structural analysis of recombinant MT-CO2 advance our understanding of cytochrome c oxidase function?

Structural analysis of recombinant Aotus nigriceps MT-CO2 provides critical insights into the functional mechanisms of cytochrome c oxidase through comparative and interventional approaches. By integrating recombinant MT-CO2 into purified cytochrome c oxidase complexes and applying advanced spectroscopic techniques like resonance Raman spectroscopy, researchers can observe real-time conformational changes in the heme structure during electron transfer processes . This approach has already revealed significant spectral shifts at key frequencies (1,562/1,592 cm⁻¹ and 1,673/1,644 cm⁻¹) that correspond to alterations in the spin state of heme and hydrogen bonding interactions when regulatory proteins bind to the complex .

Crystallographic studies complemented by molecular simulation using COOT software can identify potential binding sites and structural clefts near the active centers of cytochrome c oxidase that influence enzyme efficiency . These analyses help map the three-dimensional relationships between MT-CO2 and other subunits, particularly around metal-coordinating regions that are critical for electron transfer. By comparing the structural features of Aotus nigriceps MT-CO2 with those of other species, researchers can identify conserved domains that maintain essential functions versus variable regions that may contribute to species-specific metabolic adaptations. This comparative structural biology approach helps elucidate how subtle amino acid differences translate into functional variations in cytochrome c oxidase activity, potentially revealing targets for therapeutic interventions in mitochondrial disorders .

What are common challenges in expressing recombinant Aotus nigriceps MT-CO2 and how can they be addressed?

Expressing recombinant Aotus nigriceps MT-CO2 presents several challenges that require specific methodological adjustments. One primary difficulty is protein misfolding due to the hydrophobic nature of this membrane protein. This can be addressed by using fusion tags like maltose-binding protein (MBP), which has successfully facilitated proper folding of recombinant proteins that integrate into cytochrome c oxidase complexes . Additionally, expression at reduced temperatures (16-20°C) with slower induction rates using 0.1-0.5 mM IPTG can improve correct folding.

Another common issue is the toxicity of MT-CO2 to host cells when overexpressed. This can be mitigated by using tightly regulated expression systems like pET with T7lac promoters and employing host strains with additional regulatory elements such as pLysS. Low copper incorporation, which affects protein function, can be addressed by supplementing growth media with 50-100 μM CuSO₄ during induction and ensuring adequate aeration of cultures . For problems with protein solubility, optimization of detergent selection is crucial—n-dodecyl β-D-maltoside (DDM) at 1% concentration typically offers good results for membrane protein extraction while maintaining native structure.

Confirming proper incorporation of recombinant MT-CO2 into functional complexes requires specialized assays. Researchers should validate integration using blue native polyacrylamide gel electrophoresis (BN-PAGE) followed by immunoblotting, which has proven effective in demonstrating that recombinant proteins like Higd1a can successfully integrate into bovine heart cytochrome c oxidase complexes . This validation approach confirms that the recombinant protein not only expresses but also maintains its ability to interact appropriately with partner proteins.

How can researchers differentiate between authentic MT-CO2 sequences and nuclear mitochondrial DNA segments (NUMTs)?

Differentiating between authentic MT-CO2 sequences and nuclear mitochondrial DNA segments (NUMTs) requires a multi-faceted authentication strategy. Begin by extracting DNA from mitochondria-enriched samples through differential centrifugation before PCR amplification, which reduces the likelihood of NUMT contamination. During sequence analysis, examine the reading frame integrity—authentic MT-CO2 maintains an uninterrupted open reading frame, while NUMTs often contain premature stop codons or frameshift mutations . The GenBank entry AF181085, labeled as a NUMT from A. azarae, provides a reference point for identifying NUMT characteristics in Aotus species .

Conduct comparative sequence analysis by calculating transition/transversion ratios and synonymous/non-synonymous substitution rates. Authentic mitochondrial sequences typically show higher transition/transversion ratios and stronger purifying selection (lower dN/dS ratios) compared to NUMTs. For ambiguous cases, perform phylogenetic placement analysis—authentic MT-CO2 sequences will cluster with verified mitochondrial sequences from related species, while NUMTs often show anomalous positioning .

Additional validation can come from amplifying overlapping fragments spanning the mitochondrial genome regions adjacent to MT-CO2. Authentic mitochondrial sequences will show consistent linkage with neighboring mitochondrial genes, whereas NUMTs often show chimeric patterns or unexpected genomic contexts. For definitive confirmation in critical research, consider deep sequencing approaches that can detect heteroplasmy patterns characteristic of authentic mitochondrial DNA, which typically shows higher copy numbers than nuclear genes .

What quality control measures are essential when working with recombinant Aotus nigriceps MT-CO2 for functional studies?

Implementing rigorous quality control measures is essential when working with recombinant Aotus nigriceps MT-CO2 for functional studies. Begin with sequence verification through bidirectional Sanger sequencing of the expression construct to confirm the absence of unwanted mutations that could affect protein function. After protein expression, assess purity using SDS-PAGE (>95% purity recommended) and confirm identity through Western blotting with specific antibodies or mass spectrometry analysis .

For functional validation, determine copper incorporation rates using atomic absorption spectroscopy or inductively coupled plasma mass spectrometry, as proper metal cofactor loading is critical for MT-CO2 function. Structural integrity should be assessed through circular dichroism spectroscopy to confirm proper secondary structure formation, particularly the alpha-helical content characteristic of MT-CO2 . Additionally, thermal stability assays using differential scanning fluorimetry can evaluate protein folding quality by measuring melting temperatures.

Most critically, functional integration must be verified through in vitro reconstitution assays with purified cytochrome c oxidase complexes. Blue native polyacrylamide gel electrophoresis (BN-PAGE) followed by immunoblotting has successfully demonstrated that recombinant proteins can integrate into purified bovine heart cytochrome c oxidase, confirming their biological relevance . Functional activity should be measured through oxygen consumption assays using oxygen electrodes or spectrophotometric methods tracking cytochrome c oxidation rates. Finally, resonance Raman spectroscopy provides valuable quality control by detecting characteristic spectral signatures of properly folded and functionally active cytochrome c oxidase components, with specific bands at frequencies like 1,372 cm⁻¹ (indicative of ferric heme) confirming proper heme incorporation into the recombinant complex .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.