Recombinant Aotus trivirgatus Hemoglobin subunit beta (HBB)

What is Aotus trivirgatus Hemoglobin subunit beta and what are its key structural characteristics?

Aotus trivirgatus (owl monkey) hemoglobin subunit beta is a globin protein involved in oxygen transport from the lungs to peripheral tissues. It belongs to the globin family with the following key characteristics:

• Protein length: 146 amino acids

• Molecular weight: 15.9 kDa

• Primary sequence: VHLTGEEKAAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFDSFGDLSSPDAVMNNPKVKAHGKKVLGAFSDGLAHLDNLKGTFAQLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKYH

Like other hemoglobins, it forms part of a heterotetrameric complex in its native state, consisting of two alpha and two beta subunits. The protein contains a heme group that directly binds oxygen molecules, enabling its transport function. The tertiary structure consists of alpha-helical regions that create a pocket for heme binding, which is critical for its oxygen transport functionality.

What expression systems are most effective for producing recombinant Aotus trivirgatus HBB?

Several expression systems can be utilized for recombinant Aotus trivirgatus HBB production, each with distinct advantages:

Wheat germ cell-free system:

• Provides eukaryotic machinery for proper folding

• Effective for producing functional hemoglobin fragments

• Yields protein suitable for ELISA and Western blotting applications

E. coli expression system:

• Cost-effective and high-yield

• Requires optimization of culture conditions (temperature, IPTG concentration)

• Often requires refolding protocols to ensure proper tertiary structure

Methodological approach:

• Clone the Aotus trivirgatus HBB gene into an appropriate expression vector with a purification tag

• Transform into the selected expression system

• Optimize expression conditions (temperature, induction timing, media composition)

• Implement purification strategies that preserve the protein's native conformation

• Validate folding and functionality through spectroscopic methods

For functional studies, co-expression with alpha-globin and incorporation of heme may be necessary to form the complete hemoglobin tetramer with oxygen-binding capability.

What analytical techniques best characterize the oxygen binding properties of recombinant Aotus HBB?

The oxygen binding properties of recombinant Aotus HBB require multiple complementary analytical approaches:

Spectroscopic methods:

• UV-visible spectroscopy to monitor the characteristic absorbance shift between deoxy (430 nm) and oxy (415 nm) forms

• Circular dichroism (CD) to assess secondary structure integrity

• Resonance Raman spectroscopy to examine heme-protein interactions

Functional analysis:

• Oxygen equilibrium curves using specialized tonometry techniques

• Hill plot analysis to determine cooperativity of oxygen binding

• Measurement of P50 values (oxygen tension at 50% saturation) under varying pH and temperature conditions

Methodological workflow:

• Prepare the reconstituted hemoglobin tetramer with proper stoichiometry

• Equilibrate samples at controlled temperatures

• Record absorbance changes at multiple oxygen tensions

• Calculate binding constants and cooperativity coefficients

• Compare results with human HBB to identify functional differences

This comprehensive characterization provides insights into evolutionary adaptations in oxygen transport mechanisms among different primate species.

How can researchers validate correct folding and heme incorporation in recombinant Aotus HBB?

Validating correct folding and heme incorporation requires multiple complementary approaches:

Spectroscopic validation:

• UV-visible absorbance spectrum analysis to confirm characteristic Soret band (~415 nm) and Q bands (500-600 nm range)

• Circular dichroism to verify alpha-helical secondary structure

• Fluorescence spectroscopy to assess tertiary structure through tryptophan emission profiles

Functional validation:

• Oxygen binding assays to confirm functional activity

• CO binding kinetics as a proxy for ligand binding capacity

• Measurement of redox potential

Structural validation:

• Size exclusion chromatography to confirm appropriate oligomeric state

• Limited proteolysis patterns compared to native protein

• Thermal stability measurements (DSC or DSF) compared to reference standards

Researchers should implement a validation pipeline that combines at least one method from each category to ensure comprehensive assessment of protein quality before proceeding with experimental applications.

How does Aotus trivirgatus HBB compare structurally and functionally to human HBB?

Comparative analysis of Aotus trivirgatus and human HBB reveals both conservation and divergence:

Sequence comparison:
The Aotus trivirgatus HBB sequence (VHLTGEEKAAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFDSFGDLSSPDAVMNNPKVKAHGKKVLGAFSDGLAHLDNLKGTFAQLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKYH) shows high conservation with human HBB, particularly in the heme-binding pocket and subunit interface regions. Key differences occur primarily in surface-exposed residues.

Functional differences:

• Aotus hemoglobin typically shows slightly different oxygen affinity compared to human hemoglobin, reflecting evolutionary adaptations to different physiological requirements

• The Bohr effect (pH sensitivity of oxygen binding) may differ quantitatively between the species

• Response to allosteric modulators like 2,3-DPG may vary in magnitude

Glycation susceptibility:
Both human and Aotus HBB undergo non-enzymatic glycation at the N-terminus, forming stable ketoamine linkages throughout the 120-day lifespan of red blood cells . This modification has significant implications for diabetes research models.

Methodological approach for comparison:

• Perform side-by-side biochemical characterization

• Measure oxygen binding parameters under identical conditions

• Test response to allosteric modulators

• Evaluate stability under varying pH and temperature

How can recombinant Aotus HBB be used in studies of malarial parasite interactions?

Recombinant Aotus HBB offers valuable opportunities for malaria research:

Research applications:

• Host-parasite interaction studies

• Vaccine development platforms

• Drug resistance mechanisms

• Parasite metabolism investigations

Methodological approaches:

• In vitro culture systems using reconstituted erythrocytes with recombinant Aotus HBB

• Binding studies between parasite proteins and recombinant HBB

• Structural studies of parasite-HBB complexes

• Comparative studies with human HBB to identify species-specific interactions

Aotus monkeys are established models for malaria research, with demonstrated susceptibility to Plasmodium falciparum infection . Their hemoglobin serves as a substrate for parasite metabolism during infection. In vaccine development studies, recombinant fragments of parasite antigens have shown protective effects in Aotus monkeys, reducing parasitemia by 50-1000 fold compared to controls .

How do post-translational modifications affect Aotus HBB structure and function?

Post-translational modifications significantly impact Aotus HBB properties:

Glycation:
Glucose reacts non-enzymatically with the N-terminus of the beta chain, forming stable ketoamine linkages. This process occurs slowly throughout the 120-day lifespan of red blood cells . Glycation affects:

• Oxygen binding affinity (typically reduces it)

• Protein stability

• Susceptibility to oxidative damage

• Interaction with other cellular components

Oxidative modifications:

• Oxidation of specific residues (particularly cysteines and methionines)

• Formation of disulfide bridges

• Carbonylation reactions

Methodological approach to study modifications:

• Mass spectrometry for precise identification of modification sites

• Controlled in vitro modification followed by functional assays

• Comparison of oxygen binding properties before and after modification

• Proteomics approaches to quantify modification levels

Research implications:
Understanding these modifications provides insights into hemoglobin aging, diabetes-related complications, and evolutionary adaptations to oxidative stress. The rate of glycation increases in diabetic conditions, making modified Aotus HBB potentially valuable for comparative studies with human diabetic hemoglobin.

What site-directed mutagenesis approaches can reveal about functional domains in Aotus HBB?

Site-directed mutagenesis offers powerful insights into structure-function relationships:

Key target residues:

• Heme pocket residues (histidines and phenylalanines)

• Subunit interface residues

• Surface residues differing between Aotus and human HBB

• 2,3-DPG binding site residues

Methodological approach:

• Design mutations based on sequence alignments and structural models

• PCR-based site-directed mutagenesis of the recombinant gene

• Express and purify mutant proteins using standardized protocols

• Characterize functional properties using oxygen binding assays

• Perform structural analysis to correlate changes with functional effects

Analytical framework:
Create a series of chimeric proteins containing domains from both human and Aotus HBB to map species-specific functional differences. Systematic mutation of key residues that differ between species provides insights into evolutionary adaptations in oxygen transport mechanisms.

How can recombinant Aotus HBB contribute to hemoglobinopathy research?

Recombinant Aotus HBB provides valuable perspectives for hemoglobinopathy research:

Comparative disease modeling:

• Engineer disease-relevant mutations (e.g., sickle cell mutation) into Aotus HBB

• Compare properties with equivalent human mutants

• Identify species-specific factors that modify disease phenotypes

Therapeutic development platform:

• Test small molecule stabilizers

• Evaluate antisickling compounds

• Screen for agents that modify hemoglobin properties

Methodological approach:

• Generate paralleled mutant libraries in both human and Aotus HBB

• Perform side-by-side functional characterization

• Evaluate aggregation propensity and stability

• Test therapeutic candidates against both species' proteins

The beta-globin gene (HBB) is part of a multigene locus on chromosome 11 in humans . Mutations in this gene produce variants implicated in genetic disorders such as sickle-cell disease and beta thalassemia . At least 50 disease-causing mutations have been discovered in the human gene . Comparative studies using Aotus HBB can help distinguish universal versus species-specific mechanisms of these diseases.

What experimental approaches can detect structural changes in recombinant HBB under different oxygen tensions?

Detecting structural changes requires sophisticated biophysical techniques:

Time-resolved methodologies:

• Stopped-flow spectroscopy to capture rapid conformational changes

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational dynamics

• FRET-based sensors to monitor domain movements

Static structural analysis:

• X-ray crystallography of oxy- and deoxy-states

• Cryo-EM to capture different conformational states

• NMR spectroscopy for solution-state dynamics

Computational approaches:

• Molecular dynamics simulations to model oxygen binding-induced changes

• Normal mode analysis to identify coordinated motions

• Comparative modeling between human and Aotus HBB

Experimental setup:
Establish controlled oxygen tension using specialized tonometry equipment that allows precise manipulation of oxygen partial pressure while monitoring spectroscopic or structural parameters. Compare results between recombinant Aotus HBB and human HBB to identify species-specific conformational responses.

What are the optimal conditions for long-term storage of recombinant Aotus HBB?

Proper storage conditions are critical for maintaining protein integrity:

Storage buffer considerations:

• pH stability range (typically 7.0-8.0)

• Buffer components (phosphate vs. Tris vs. HEPES)

• Ionic strength optimization

• Reducing agents (DTT, β-mercaptoethanol) to prevent oxidation

• Stabilizing additives (glycerol, sucrose)

Physical parameters:

• Temperature (-80°C for long-term; -20°C with glycerol for medium-term)

• Light exposure (protect from light to prevent photooxidation)

• Freeze-thaw cycles (minimize; aliquot before freezing)

• Protein concentration (typically 1-5 mg/mL for optimal stability)

Stability monitoring:

• Periodic functional testing (oxygen binding assays)

• Spectroscopic analysis to detect denaturation

• Size exclusion chromatography to monitor aggregation

• Activity assays compared to fresh protein preparations

For optimal results, store recombinant Aotus HBB in 50 mM phosphate buffer (pH 7.4) with 100 mM NaCl and 10% glycerol at -80°C in single-use aliquots to prevent repeated freeze-thaw cycles.

What methodological approaches address challenges in achieving high purity of recombinant Aotus HBB?

Purification of recombinant Aotus HBB requires specialized approaches:

Multi-step purification strategy:

• Initial capture using affinity chromatography (His-tag or heme-binding properties)

• Intermediate purification using ion exchange chromatography

• Polishing step using size exclusion chromatography

• Optional: Hydroxyapatite chromatography for removal of misfolded species

Critical parameters to optimize:

• Lysis conditions to prevent protein denaturation

• Buffer composition during purification steps

• Temperature control throughout the process

• Protease inhibitor cocktails to prevent degradation

• Reducing agents to maintain proper redox state

Quality control metrics:

• SDS-PAGE analysis (target >95% purity)

• Mass spectrometry verification

• Spectroscopic confirmation of heme incorporation

• Functional activity assessment

Researchers can monitor purification progress using SDS-PAGE, similar to the analysis performed for recombinant human hemoglobin subunit beta which demonstrates effective visualization on 12.5% SDS-PAGE stained with Coomassie Blue .