Recombinant Aotus trivirgatus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

What is the basic structure of MT-ND4L protein?

MT-ND4L is an 11 kDa protein composed of 98 amino acids that forms part of Complex I in the mitochondrial respiratory chain. The amino acid sequence for Aotus trivirgatus MT-ND4L is MPFIYINVLLAYFMSLLGLLIYRSHLMSSLLCLEGMMLSLFIMATLMTLNMHLTLYMMP IVLLVFAACEAAVGLALLVLISNLYGLDYVQNLNLLQC, with a highly hydrophobic composition that facilitates its integration into the mitochondrial inner membrane . The protein contains multiple transmembrane domains that contribute to the core architecture of Complex I. Structural analyses show that MT-ND4L and other mitochondrially encoded subunits are among the most hydrophobic components of Complex I and form the core of the transmembrane region, which is critical for proper complex assembly and function .

How does MT-ND4L contribute to mitochondrial function?

MT-ND4L functions as a core subunit of respiratory chain Complex I (NADH dehydrogenase), which is essential for electron transfer and proton translocation across the inner mitochondrial membrane . As part of Complex I, MT-ND4L participates in the first step of the electron transport chain, helping to transfer electrons from NADH to ubiquinone while pumping protons from the mitochondrial matrix to the intermembrane space . This process contributes to establishing the proton gradient necessary for ATP synthesis. Research indicates that MT-ND4L and neighboring subunits may form part of a proton translocation pathway, directly contributing to the energy conversion process in mitochondria . The protein's strategic positioning within the transmembrane domain makes it crucial for maintaining the structural integrity required for efficient electron transport.

What is the relationship between human and Aotus trivirgatus MT-ND4L?

Aotus trivirgatus (Three-striped night monkey) MT-ND4L shares significant homology with human MT-ND4L, making it a valuable model for comparative studies of mitochondrial function across primate species . Both proteins serve identical functions in their respective species' mitochondria as components of Complex I. The high conservation of sequence and function across species highlights the evolutionary importance of this protein in maintaining mitochondrial energy production. Comparative studies between human and Aotus trivirgatus MT-ND4L can provide insights into the evolution of mitochondrial proteins and how structural variations might affect function, potentially revealing adaptive mechanisms that have developed in different primate lineages.

What expression systems are most effective for producing recombinant MT-ND4L?

For recombinant expression of Aotus trivirgatus MT-ND4L, E. coli has been demonstrated as an effective heterologous expression system . When expressing highly hydrophobic mitochondrial membrane proteins like MT-ND4L, researchers should consider the following methodological approaches:

• Vector selection: Vectors containing strong promoters (T7, tac) and appropriate fusion tags (particularly His-tags for purification) improve expression efficiency

• Expression conditions: Lower temperatures (16-25°C) and reduced inducer concentrations often enhance proper folding

• Specialized E. coli strains: C41(DE3) and C43(DE3) strains are engineered for membrane protein expression

• Co-expression with chaperones: May improve folding and prevent aggregation

The recombinant protein can be expressed with N-terminal His-tags to facilitate purification while minimizing interference with the protein's native structure and function . Alternative expression systems such as yeast or mammalian cells might provide better post-translational modifications but typically yield lower quantities of protein.

What are the optimal purification methods for recombinant MT-ND4L?

Purification of recombinant MT-ND4L presents challenges due to its hydrophobic nature and membrane protein characteristics. A methodological approach based on available research includes:

Table 1: Recommended Purification Strategy for Recombinant MT-ND4L

After purification, the protein should achieve greater than 90% purity as determined by SDS-PAGE . Repeated freeze-thaw cycles should be avoided to maintain protein integrity. For long-term storage, addition of 5-50% glycerol and aliquoting before storage at -20°C/-80°C is recommended to preserve structural and functional properties .

How can researchers verify the structural integrity of purified recombinant MT-ND4L?

Verification of recombinant MT-ND4L structural integrity requires multiple analytical approaches:

• SDS-PAGE and Western blotting: Confirms protein size and immunoreactivity using anti-His or specific anti-MT-ND4L antibodies

• Circular Dichroism (CD) spectroscopy: Evaluates secondary structure content, particularly important for confirming proper alpha-helical content expected in membrane proteins

• Limited proteolysis: Provides information about protein folding by identifying accessible protease sites

• Mass spectrometry: Confirms protein identity and can detect post-translational modifications or truncations

• Functional assays: Activity measurements such as NADH oxidation rates when incorporated into membrane-mimetic environments

For membrane proteins like MT-ND4L, structural analysis in detergent micelles or reconstituted proteoliposomes provides the most physiologically relevant assessment of protein integrity . Molecular dynamics simulations can complement experimental approaches by predicting structural characteristics and conformational changes in a membrane environment, particularly when examining the effects of mutations on protein function .

How can recombinant MT-ND4L be used to study proton translocation mechanisms?

Recombinant MT-ND4L provides a valuable tool for investigating proton translocation mechanisms within Complex I. Studies employing molecular dynamics (MD) simulations reveal that MT-ND4L and ND6 subunits may form part of a fourth proton translocation pathway in Complex I . A methodological framework for such investigations includes:

• Reconstitution of purified recombinant MT-ND4L (alone or with other subunits) into liposomes or nanodiscs

• Measurement of proton flux using pH-sensitive fluorescent dyes (BCECF, pyranine)

• Site-directed mutagenesis of key residues predicted to participate in proton channels

• Complementary computational approaches using MD simulations to visualize water channels and proton movement

Research has demonstrated that mutations in MT-ND4L, such as M47T and C69W, can disrupt normal proton translocation pathways by altering hydrogen bonding patterns between key residues. For example, these mutations can cause formation of hydrogen bonds between Glu34 and Tyr157, restricting the passage of water molecules through the transmembrane region . This molecular insight connects structural alterations to functional consequences, potentially explaining how MT-ND4L mutations contribute to pathophysiological conditions.

What methodological approaches can be used to study the effects of MT-ND4L mutations?

Investigating the effects of MT-ND4L mutations requires integrating computational and experimental methodologies:

Computational approaches:

• Homology modeling to generate structural models of native and mutant proteins (using tools like MODELLER)

• Model evaluation using metrics such as DOPE scores and stereochemical validation

• Building transmembrane systems with appropriate lipid bilayers (using tools like CHARMM-GUI)

• Molecular dynamics simulations to assess structural and functional consequences of mutations

• Analysis of hydrogen bonding patterns and water molecule movements through potential proton channels

Experimental approaches:

• Site-directed mutagenesis to generate mutant recombinant proteins

• Biochemical assays measuring enzyme activity (NADH oxidation, ubiquinone reduction)

• Membrane potential measurements in reconstituted systems

• Structural studies using techniques such as cryo-EM

• Cell-based assays using cybrid cells harboring specific mitochondrial mutations

This integrated approach has successfully identified mechanisms by which mutations like T10609C (M47T) and C10676G (C69W) in MT-ND4L disrupt proton translocation pathways, potentially contributing to conditions such as Type 2 diabetes mellitus and cataracts .

What is the role of MT-ND4L in mitochondrial disease pathogenesis?

MT-ND4L mutations have been implicated in several mitochondrial disorders through disruption of Complex I function. Variants of human MT-ND4L are associated with increased BMI in adults and Leber's Hereditary Optic Neuropathy (LHON) . The pathogenesis involves several mechanistic pathways:

• Impaired proton translocation: Mutations can alter the protein structure in ways that disrupt proton channels, reducing the efficiency of energy conversion

• Reactive oxygen species (ROS) production: Dysfunctional Complex I often leads to increased ROS generation, causing oxidative damage to mitochondrial proteins, lipids, and DNA

• Reduced ATP synthesis: The decreased proton gradient resulting from MT-ND4L dysfunction leads to reduced ATP production, particularly affecting high-energy-demanding tissues like neural tissue

• Altered mitochondrial dynamics: Complex I dysfunction can trigger changes in mitochondrial morphology, distribution, and turnover

Research methodologies for investigating these pathogenic mechanisms include cybrid cell models, patient-derived fibroblasts, and animal models carrying specific MT-ND4L mutations. These approaches enable researchers to connect molecular alterations to cellular phenotypes and ultimately to clinical manifestations of mitochondrial diseases .

How does Aotus trivirgatus MT-ND4L compare structurally and functionally with MT-ND4L from other species?

Comparative analysis of MT-ND4L across species provides evolutionary insights into this conserved mitochondrial protein. The Aotus trivirgatus MT-ND4L shares significant sequence homology with human MT-ND4L, reflecting the protein's evolutionary importance . Key comparative aspects include:

Table 2: Comparative Features of MT-ND4L Across Selected Species

What unique features of Aotus trivirgatus MT-ND4L make it valuable for research?

Aotus trivirgatus (Three-striped night monkey) MT-ND4L offers several advantages as a research model:

• Evolutionary positioning: As a New World monkey, Aotus provides an intermediate evolutionary perspective between human and more distant mammalian models, offering insights into primate-specific adaptations of mitochondrial proteins

• Nocturnal adaptation: The nocturnal lifestyle of Aotus may have driven specific adaptations in mitochondrial energy metabolism that can provide comparative insights into how energy production systems adapt to different activity patterns

• Biomedical relevance: Aotus species are important models for certain human diseases, particularly malaria, making their mitochondrial function studies potentially relevant to understanding host-pathogen interactions at the metabolic level

• Recombinant expression viability: The successful expression of recombinant Aotus MT-ND4L in E. coli systems demonstrates its technical accessibility for laboratory studies

Researchers can exploit these unique features through comparative biochemical studies, evolutionary analyses, and structure-function investigations that parallel human studies, potentially revealing conserved mechanisms of mitochondrial energy production and disease pathogenesis across primate lineages .

What are the major challenges in working with recombinant MT-ND4L and how can they be addressed?

Working with recombinant MT-ND4L presents several technical challenges due to its hydrophobic nature and membrane protein characteristics. These challenges and their methodological solutions include:

• Low expression yields:

  • Solution: Optimize codon usage for the expression host

  • Use specialized expression strains (C41/C43)

  • Employ fusion partners that enhance solubility (MBP, SUMO)

  • Consider cell-free expression systems for toxic proteins

• Protein aggregation:

  • Solution: Express at lower temperatures (16-20°C)

  • Use milder induction conditions

  • Co-express with molecular chaperones

  • Add stabilizing agents during purification

• Maintaining structural integrity:

  • Solution: Select appropriate detergents (DDM, LDAO, Fos-choline)

  • Consider lipid nanodiscs or amphipols for a more native-like environment

  • Implement quality control at each purification step

  • Validate structural integrity through multiple complementary techniques

• Functional assessment:

  • Solution: Develop specialized assays to measure activity in isolated systems

  • Reconstitute with partner proteins to form functional subcomplexes

  • Use complementation studies in suitable cellular models

The successful expression of Aotus trivirgatus MT-ND4L with an N-terminal His-tag in E. coli demonstrates that these challenges can be overcome with appropriate methodological approaches . Storage in buffer containing 6% trehalose at pH 8.0 and avoiding repeated freeze-thaw cycles helps maintain protein stability for extended research use .

How can researchers effectively design mutation studies to understand MT-ND4L function?

Designing effective mutation studies for MT-ND4L requires a systematic approach combining computational prediction and experimental validation:

Step 1: Mutation Site Selection

• Identify conserved residues through multiple sequence alignment across species

• Target residues predicted to be in functional domains (proton channels, subunit interfaces)

• Focus on sites where naturally occurring mutations are associated with disease

• Select sites based on computational predictions of structural importance

Step 2: Computational Assessment

• Perform homology modeling of wild-type and mutant proteins

• Conduct molecular dynamics simulations to predict conformational changes

• Analyze effects on hydrogen bonding networks and water channel formation

• Calculate energetic changes associated with mutations

Step 3: Experimental Validation

• Generate mutant constructs using site-directed mutagenesis

• Express and purify mutant proteins using optimized protocols

• Compare structural properties using spectroscopic methods

• Assess functional impact through activity assays and reconstitution studies

Step 4: Integrated Analysis

• Correlate computational predictions with experimental findings

• Develop mechanistic models explaining how specific mutations affect function

• Apply findings to understand disease-associated mutations

This systematic approach has successfully revealed how mutations such as M47T (T10609C) and C69W (C10676G) in MT-ND4L disrupt proton translocation pathways through altered hydrogen bonding patterns and restricted water molecule movement .