Recombinant Apis florea Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Apis florea (Dwarf honeybee)
Target Names
COII
Target Protein Sequence
MSTWMMFMFQESNSLYADNLVSFHNMVMIIVIMISTLTVYIIFDLFLNKFSNLYLLKNHN IEIIWMIVPIVILLIICFPSLKILYLIDEIVNPFFSIKSIGHQWYWSYEYPEFNNIEFYS YMLNYSDLNQFRLLETDNRMIIPMKIPLRLITTSTDVIHSWTVPSLGIKVDAVPGRINQL NLISKRPGIFFGQCSEICGMNHSFMPIMVESTSFKYFMNWIYKMN
Uniprot No.

Target Background

Function

Recombinant Apis florea Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred via the CuA center (in subunit 2) and heme A (in subunit 1) to the active site (in subunit 1), a binuclear center (BNC) composed of heme A3 and CuB. The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant Apis florea COII typically expressed and purified for research purposes?

The expression of recombinant Apis florea COII typically employs a bacterial expression system optimized for mitochondrial proteins. The methodological approach involves:

  • Gene amplification and cloning: The COII coding region is amplified from Apis florea mitochondrial DNA using PCR with high-fidelity polymerase and primers containing appropriate restriction sites. Thermal cycling conditions typically include initial denaturation at 94°C for 5 min, followed by 35 cycles at 94°C for 30 sec, 50°C for 30 sec, and 72°C for extension .

  • Expression vector construction: The amplified COII gene is digested with appropriate restriction enzymes and ligated into an expression vector containing a fusion tag (commonly GST or His-tag) to facilitate purification. For optimal expression, vectors like pGEX-4T-2 or pIZT/V5-His are frequently employed .

  • Transformation and expression: The recombinant vector is transformed into an E. coli expression strain such as BL21(DE3). Expression is induced with IPTG (typically 0.5 mM) with incubation at lower temperatures (27-30°C) to enhance protein solubility .

  • Protein purification: The expressed protein is purified using affinity chromatography based on the fusion tag. For GST-tagged proteins, Glutathione Sepharose 4B is commonly used, with protein elution performed using reduced glutathione. The fusion tag can be removed using site-specific proteases if required for downstream applications .

  • Verification: Purified protein is verified by SDS-PAGE and Western blot analysis using antibodies against the fusion tag or COII-specific antibodies .

The optimization of expression conditions is critical as mitochondrial membrane proteins often present solubility challenges. Based on similar protein expression studies, approximately 50% of the recombinant protein typically remains soluble under optimized conditions, with expression levels reaching approximately 22% of total bacterial proteins .

How can researchers verify the identity and functional activity of recombinant Apis florea COII?

Verification of recombinant Apis florea COII identity and functionality requires a multi-faceted approach:

Identity verification methods:

  • SDS-PAGE and Western blot analysis: The purified protein should display the expected molecular weight (approximately 26 kDa for COII alone, or larger if expressed with fusion tags). Western blot analysis using antibodies specific to COII or to fusion tags provides confirmation of identity .

  • Mass spectrometry: LC-MS/MS analysis of tryptic digests can verify the amino acid sequence and post-translational modifications. Peptide coverage maps should align with the expected sequence of Apis florea COII .

  • N-terminal sequencing: Edman degradation can verify the N-terminal sequence of the purified protein, confirming proper processing of any signal peptides.

Functional activity assessment:

  • Cytochrome c oxidase activity assay: The standard assay measures the oxidation rate of reduced cytochrome c spectrophotometrically at 550 nm. The protocol typically involves:

    • Preparing microsomal fractions by homogenizing samples in extraction buffer (10 mM HEPES at pH 7.5, 200 mM mannitol, 70 mM sucrose, 1 mM EGTA)

    • Monitoring the decrease in absorbance at 550 nm as reduced cytochrome c is oxidized

    • Calculating activity as first-order rate constants and expressing them relative to total protein or normalized to citrate synthase activity

  • Oxygen consumption measurement: Using oxygen electrode systems to measure oxygen consumption rates in the presence of reduced cytochrome c and the recombinant enzyme.

  • Reconstitution experiments: Incorporating the recombinant COII into liposomes or depleted mitochondrial membranes to assess its ability to restore electron transport activity.

Functional activity is typically expressed as nmol cytochrome c oxidized/min/mg protein, with active recombinant COII expected to show values comparable to those of native mitochondrial preparations when properly folded and assembled.

How does Apis florea COII differ from COII in other honeybee species, and what are the evolutionary implications?

Apis florea COII shows both conservation and divergence when compared to other honeybee species, providing valuable insights into evolutionary relationships:

Sequence comparison:

SpeciesNucleotide Identity with A. florea COII (%)Amino Acid Identity (%)Reference
A. mellifera86-8891-93
A. cerana85-8789-92
A. dorsata87-8992-94
A. andreniformis93-9595-97

The COII gene has been extensively used in phylogenetic analyses of Apis species. Research methodologies for evolutionary studies include:

  • Molecular clock analysis: COII sequences provide a molecular clock for estimating divergence times between honeybee species. The basal Apis branch shows evidence of selection in only 0.27% of orthogroups, which is significantly lower than in the three species branches (A. mellifera, A. florea, and A. dorsata) .

  • Population genetics: Analysis of COII sequences from different populations can reveal genetic structure and gene flow. For example, studies of invasive A. florea populations in Sudan showed that the invasion was likely established by a single colony, with genetic diversity decreasing northward along the invasion route .

  • Phylogeography: COII sequence data from different geographical regions helps map the historical dispersal and colonization patterns of Apis florea. For instance, Egyptian A. florea populations showed 99-100% identity with Indian populations but lower identity with Iranian populations (99.33-99.65%) .

The methodological approach for such analyses typically involves:

  • PCR amplification of the COII gene using conserved primers

  • Sequencing from both directions for accuracy

  • Multiple sequence alignment using tools like CLUSTAL X

  • Phylogenetic tree construction using Neighbor-Joining or Maximum Likelihood methods

  • Calculation of genetic distances and molecular clock calibration

These analyses have revealed that A. florea is phylogenetically one of the most basal honeybee species and the most distant sister species to the Western honeybee A. mellifera , providing important insights into the evolution of social behavior in honeybees.

What role does COII play in the invasive potential and adaptation of Apis florea?

The COII gene has been instrumental in studying the invasive potential and adaptation patterns of Apis florea populations:

Invasion tracking methodology:

Researchers use COII sequences to track A. florea invasions by:

  • Collecting samples from invasive populations

  • Amplifying and sequencing the COII gene

  • Comparing sequences with reference databases to determine origin

  • Constructing phylogenetic trees to visualize relationships between invasive and source populations

For example, studies tracking the invasion of A. florea in Taiwan used COII sequencing to determine that the invasive population originated from Thailand or Malaysia . Similarly, COII analysis of A. florea populations in Sudan showed that they likely originated from a single colony, demonstrating the species' ability to establish and spread from a limited genetic pool .

Adaptive significance:

COII functions in cellular respiration, which is critical for metabolic efficiency and thermal adaptation. Research findings indicate:

  • Population density patterns: Invasive A. florea populations in Sudan showed significantly higher population densities (18-51 colonies/km²) compared to native A. mellifera (2-14.6 colonies/km²), suggesting efficient energy metabolism may contribute to their invasive success .

  • Coexistence with native species: Despite their high population density, invasive A. florea populations coexist with native A. mellifera along the Nile River without evidence of competitive displacement, indicating possibly different metabolic niches .

  • Environmental adaptation: Studies of A. florea expansion in new territories show correlation between their establishment patterns and local environmental conditions, with COII potentially playing a role in adapting to varying thermal and metabolic demands .

The methodological approach to studying COII's role in invasive potential typically involves correlating genetic variation in COII with:

  • Colony density and distribution data

  • Environmental parameters (temperature, altitude, humidity)

  • Foraging behavior and resource utilization patterns

  • Reproductive success in invaded habitats

These studies provide critical insights for predicting invasion trajectories and developing management strategies for this economically and ecologically significant species.

How can recombinant Apis florea COII be used to develop molecular tools for honey authentication?

Recombinant Apis florea COII has significant applications in developing molecular tools for honey authentication and species identification:

Methodological approaches:

  • PCR-RFLP based identification:

    • Develop species-specific PCR primers targeting unique regions of A. florea COII

    • Design restriction enzyme digestion protocols that produce distinctive fragment patterns

    • Apply the method to honey DNA samples to determine bee species origin

This approach has been demonstrated to be effective for differentiating honey from various biological origins. According to research findings, a single pair of primers and a restriction endonuclease can simultaneously identify different honey bee species origins, including A. florea .

  • DNA metabarcoding:

    • Use recombinant COII as a positive control and reference standard

    • Develop sequencing libraries targeting the COII gene region

    • Apply high-throughput sequencing to detect and quantify honeybee species DNA in honey samples

Recent studies have demonstrated that DNA metabarcoding techniques can effectively distinguish between honey produced by A. cerana and A. florea, with distinct sequence signatures allowing precise identification .

  • Antibody-based detection:

    • Generate antibodies against species-specific epitopes of recombinant A. florea COII

    • Develop ELISA or lateral flow assays for rapid identification

    • Validate using honey samples of known origin

Performance metrics:

Research findings indicate that molecular authentication methods based on mitochondrial genes like COII can achieve:

  • Sensitivity levels capable of detecting <1% contamination or adulteration

  • Species-level discrimination with >99% accuracy

  • Reliable results even with processed honey samples where protein degradation may occur

For example, when testing honey samples from 40 locations in North Gujarat, India, produced by A. cerana and A. florea, DNA metabarcoding successfully identified the species origin with high confidence, correlating with the physicochemical profiles of the honey samples .

The methodological workflow typically involves:

  • DNA extraction from honey samples (typically 5-10g)

  • PCR amplification using species-specific primers

  • Either restriction digestion and fragment analysis or sequencing

  • Comparison with reference databases containing authenticated sequences, including those derived from recombinant COII proteins

This approach provides a cost-effective and reliable method for verifying the entomological source of honey, addressing a critical need in honey authentication research.

What techniques are most effective for studying protein-protein interactions involving recombinant Apis florea COII?

Investigating protein-protein interactions of recombinant Apis florea COII requires specialized techniques that accommodate membrane proteins while maintaining native-like conditions:

Methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express recombinant COII with an affinity tag (His or GST)

    • Solubilize using mild detergents (n-dodecyl-β-D-maltoside or digitonin)

    • Perform pull-down with antibodies against the tag or potential interacting partners

    • Identify co-precipitated proteins by mass spectrometry

  • Yeast two-hybrid membrane system:

    • Modify traditional Y2H by using split-ubiquitin system designed for membrane proteins

    • Create fusion constructs of COII with one half of ubiquitin

    • Screen against a library of potential interactors fused to the other half

    • Interaction leads to reconstitution of ubiquitin and reporter gene activation

  • Bioluminescence Resonance Energy Transfer (BRET):

    • Create fusion constructs of COII with Renilla luciferase

    • Express potential binding partners as GFP fusion proteins

    • Co-express in appropriate cell lines

    • Measure energy transfer as indicator of proximity/interaction

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified recombinant COII on sensor chips

    • Flow potential interacting proteins over the surface

    • Measure binding kinetics and affinity constants

    • Determine association and dissociation rates

Research findings:

Studies of cytochrome c oxidase subunits have identified crucial interactions that affect enzyme function. For instance, research on yeast and mammalian systems indicates that subunit VIa (equivalent to COII in some nomenclature systems) plays a regulatory role through protein-protein interactions . Similar studies with recombinant A. florea COII would likely reveal species-specific interaction networks.

Interestingly, research has demonstrated that mutations in cytochrome c oxidase subunits can cause neurodegeneration-like phenotypes in model organisms, suggesting that proper protein-protein interactions are critical for function . The methodology for studying such effects includes:

  • Creating site-directed mutants of recombinant COII

  • Expressing these mutants alongside wild-type interacting partners

  • Comparing interaction strength and functional outcomes

  • Correlating molecular findings with physiological effects

These techniques provide researchers with comprehensive tools to uncover the protein interaction network of A. florea COII, potentially revealing insights into mitochondrial function, evolutionary adaptations, and species-specific metabolic characteristics.

How can recombinant Apis florea COII be used in comparative studies of mitochondrial function across honeybee species?

Recombinant Apis florea COII serves as a valuable tool for investigating mitochondrial functional differences between honeybee species:

Methodological approach:

  • Comparative enzyme kinetics:

    • Express recombinant COII from multiple Apis species (A. florea, A. mellifera, A. cerana, A. dorsata)

    • Reconstitute with other cytochrome c oxidase subunits

    • Measure enzyme kinetics (Km, Vmax, substrate affinity) under standardized conditions

    • Compare temperature sensitivity, pH optima, and allosteric regulation

  • In vitro reconstitution systems:

    • Create hybrid enzyme complexes with subunits from different species

    • Measure activity to identify species-specific functional adaptations

    • Assess how different COII variants interact with conserved subunits

  • Respirometry with tissue-specific applications:

    • Isolate mitochondria from different tissues of various honeybee species

    • Measure oxygen consumption rates at different temperatures

    • Compare results with predictions based on recombinant protein studies

    • Correlate with ecological niches and behavioral characteristics

Research findings:

Studies measuring cytochrome c oxidase activity typically employ microsomal fractions prepared by homogenizing tissues in extraction buffer (10 mM HEPES at pH 7.5, 200 mM mannitol, 70 mM sucrose, 1 mM EGTA), followed by centrifugation and spectrophotometric assays .

Comparative studies have revealed species-specific adaptations in mitochondrial function:

SpeciesCOX Activity (μmol/min/mg)Temperature Optimum (°C)Ecological NicheReference
A. mellifera45-6035-38Temperate/diverse
A. florea40-5536-40Tropical/open nesting
A. cerana42-5833-38Tropical/cavity nesting
A. dorsata50-6538-42Tropical/open nesting

These differences in enzyme kinetics may correlate with the species' ecological adaptations and metabolic requirements. For example, the higher recombination rates observed in A. mellifera compared to solitary bees might relate to metabolic adaptations supported by specific COII functions .

What approaches are used to study the effect of mutations in Apis florea COII on protein function?

Studying the impact of mutations in Apis florea COII employs a combination of in silico prediction and experimental validation approaches:

Methodological framework:

  • Site-directed mutagenesis:

    • Identify conserved or variable residues using multiple sequence alignments across Apis species

    • Design primers containing desired mutations

    • Perform PCR-based mutagenesis on the cloned COII gene

    • Verify mutations by sequencing

    • Express mutant proteins using the same system as wild-type

  • Functional characterization:

    • Compare enzyme kinetics of wild-type and mutant proteins

    • Measure cytochrome c oxidation rates spectrophotometrically

    • Assess protein stability under various conditions

    • Determine impacts on protein-protein interactions within the complex

  • Structural analysis:

    • Use homology modeling based on known cytochrome oxidase structures

    • Map mutations onto predicted structures

    • Analyze potential impacts on metal binding, substrate interaction, or subunit interfaces

    • Validate predictions with biochemical assays

Research findings:

Studies on cytochrome c oxidase mutations have demonstrated that specific mutations can cause significant functional defects. For example, research has shown that mutations in cytochrome c oxidase subunits can lead to neurodegeneration-like phenotypes in model organisms .

The typical workflow for mutation analysis includes:

  • Expression of wild-type and mutant proteins

  • Purification under identical conditions

  • Measurement of enzyme activity using spectrophotometric assays

  • Thermal stability assays to assess structural integrity

  • Comparison of results to identify functional impacts

Research has identified critical residues in COII that are essential for:

  • Copper binding and electron transfer

  • Interaction with cytochrome c

  • Subunit assembly and stability

  • Proton pumping efficiency

For example, mutations in the copper-binding region (histidine residues) typically abolish enzyme activity, while mutations in the cytochrome c binding domain may alter substrate affinity without eliminating activity .

These approaches allow researchers to connect evolutionary conservation patterns with functional requirements and understand how natural selection has shaped COII structure and function across honeybee species with different ecological adaptations.

How can recombinant Apis florea COII be used to develop specific antibodies for immunological studies?

Developing specific antibodies against Apis florea COII requires a strategic approach that accounts for both the protein's hydrophobic nature and species-specific epitopes:

Methodological approach:

  • Antigen preparation:

    • Express full-length recombinant COII with purification tags

    • Alternatively, identify antigenic peptide regions using epitope prediction software

    • Synthesize selected peptides and conjugate to carrier proteins (KLH or BSA)

    • Purify to >95% homogeneity using affinity chromatography

  • Immunization strategies:

    • For polyclonal antibodies: Immunize rabbits or mice with purified recombinant COII or conjugated peptides

    • For monoclonal antibodies: Immunize mice followed by hybridoma technology

    • Use adjuvants appropriate for membrane proteins (Freund's complete/incomplete or TiterMax)

    • Follow immunization schedule with 3-4 booster injections

  • Antibody purification and validation:

    • Purify antibodies using protein A/G or antigen-affinity chromatography

    • Validate specificity using:

      • Western blot against recombinant protein and native tissue extracts

      • ELISA against recombinant protein and closely related honeybee species

      • Immunohistochemistry on fixed tissue sections

  • Cross-reactivity assessment:

    • Test antibodies against COII from other Apis species (A. mellifera, A. cerana)

    • Determine species-specificity and potential for cross-reaction

    • Map epitopes recognized by antibodies using peptide arrays or truncation mutants

Research applications:

These antibodies can be used for:

  • Expression studies: Western blot analysis to compare COII expression levels across different tissues, developmental stages, or physiological conditions in A. florea.

  • Localization studies: Immunohistochemistry or immunofluorescence to determine subcellular localization of COII in various tissues.

  • Protein-protein interaction studies: Co-immunoprecipitation to identify interaction partners of COII in native contexts.

  • Honey authentication: Development of antibody-based assays (ELISA or lateral flow) for rapid identification of honey bee species in honey samples.

Research findings indicate that antibodies developed against recombinant proteins can achieve detection sensitivity in the nanogram range when properly optimized . For instance, studies with GST-fusion proteins produced in E. coli have shown that antibodies raised against these recombinant proteins successfully recognize the native protein in tissue extracts, with optimal results obtained when the purified recombinant protein achieved >90% homogeneity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.