Recombinant Apis koschevnikovi Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Description

Core Characteristics

ParameterDetails
UniProt IDP50268
Product CodeCSB-YP015073AMJ1
Expression SystemSaccharomyces cerevisiae (yeast)
Protein LengthPartial sequence
Purity>85% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
Shelf Life12 months (lyophilized) at -20°C/-80°C

This recombinant protein is designed for research purposes and is not intended for human consumption .

Key Features

  • Mitochondrial Origin: COII is part of the mitochondrial genome, which has evolved distinct features in honeybees compared to other insects. For example, honeybee mitochondrial DNA (mtDNA) exhibits higher A+T content in COI and COII genes compared to Drosophila .

  • Sequence Variability: The COI–COII intergenic region in honeybees is a hotspot for mitochondrial genetic diversity. In Africanized bees, this region shows polymorphisms linked to distinct mitochondrial lineages (e.g., A, C, M mitotypes) .

Mitochondrial Genetics and Evolution

  • Mitotype Analysis: The COI–COII region is a marker for studying mitochondrial lineages in honeybees. For example, Africanized bees exhibit 11 distinct mitotypes, including novel A-lineage variants (A28–A30) .

  • Phylogenetic Studies: Sequence comparisons of COII across Apis species (e.g., A. mellifera, A. koschevnikovi) reveal evolutionary divergence in mitochondrial DNA .

Biochemical and Functional Studies

  • Enzyme Activity: Recombinant COII can be used to study cytochrome c oxidase assembly or interactions with other subunits.

  • Proteomic Approaches: Differential expression of COII in honeybee development (e.g., pupal stages) has been observed via 2-D gel electrophoresis .

Comparative Analysis with Related Proteins

SpeciesCOII SourceExpression SystemPuritySequence Length
Apis koschevnikoviMitochondrial DNA Yeast>85%Partial
Apis mellifera ligusticaMitochondrial DNA E. coli>90%Full-length (1–225aa)
Strongylocentrotus purpuratusMitochondrial DNA E. coli>90%Full-length (1–229aa)

Key Differences:

  • Sequence Length: Apis koschevnikovi COII is partial, while other species provide full-length sequences .

  • Expression Systems: Yeast vs. E. coli impacts post-translational modifications (e.g., glycosylation) .

Challenges and Considerations

  • Stability: Repeated freeze-thaw cycles and improper storage (e.g., non-lyophilized forms) reduce activity .

  • Cross-Species Reactivity: While COII is conserved, recombinant proteins from Apis species may show limited cross-reactivity with other insects (e.g., Vespula wasps) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To specify a tag type, please inform us, and we will prioritize its development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Apis koschevnikovi (Koschevnikov's honey bee)
Target Names
COII
Target Protein Sequence
MSTWMMFMFQESNSFYADNLVSFHNLVMMIIIMISTLTIYIIFDLFMNKFSNLFLLKNHN IEIIWTIVPIVILLIICFPSLKILYLIDEIINPFFSIKSIGHQWYWSYEYPEFNNIEFDS YMLNYSNLNQFRLLETDNRMIIPMKIPMRLITTSTDVIHSWTVPSLGIKVDAVPGRINQL NLISKRPGIFFGQCSEICGMNHSFMPIMVESTSFKFFLNWINKQN
Uniprot No.

Target Background

Function
Apis koschevnikovi Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme complex drives oxidative phosphorylation. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the Cu(A) center of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1, composed of heme A3 and Cu(B). The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Recombinant Apis koschevnikovi Cytochrome c Oxidase Subunit 2 (COII)?

    Recombinant Apis koschevnikovi Cytochrome c Oxidase Subunit 2 (COII) is a laboratory-synthesized protein corresponding to the full-length (amino acids 1-225) of the native COII protein found in the Apis koschevnikovi honey bee species. The recombinant protein is typically produced in E. coli expression systems with an N-terminal histidine tag to facilitate purification. The protein functions as a critical component of the mitochondrial respiratory chain, specifically within complex IV (cytochrome c oxidase) . The amino acid sequence of the recombinant protein is: MSTWMMFMFQESNSFYADNLVSFHNLVMMIIIMISTLTIYIIFDLFMNKFSNLFLLKNHNIEIIWTIVPIVILLIICFPSLKILYLIDEIINPFFSIKSIGHQWYWSYEYPEFNNIEFDSYMLNYSNLNQFRLLETDNRMIIPMKIPMRLITTSTDVIHSWTVPSLGIKVDAVPGRINQLNLISKRPGIFFGQCSEICGMNHSFMPIMVESTSFKFFLNWINKQN .

  • How is recombinant COII protein produced in laboratory settings?

    The production of recombinant COII involves several methodological steps:

    1. Gene isolation and cloning: The COII gene is isolated from Apis koschevnikovi genomic material using PCR with specific primers targeting the gene.

    2. Vector construction: The isolated gene is inserted into an expression vector (typically containing a His-tag sequence) following NIH guidelines for recombinant DNA research .

    3. Transformation: Competent E. coli cells are transformed with the recombinant vector.

    4. Expression: Protein production is induced in the bacterial culture, typically using IPTG or similar inducers.

    5. Purification: The expressed protein is extracted and purified using affinity chromatography that targets the His-tag.

    6. Quality control: The purified protein undergoes SDS-PAGE analysis to verify purity (>90% is typically achieved) .

    7. Lyophilization: The final product is often provided as a lyophilized powder to improve stability during storage and shipping .

  • What are the optimal storage conditions for recombinant COII protein?

    Based on empirical stability studies, the following storage protocols are recommended for maintaining recombinant COII integrity:

    Storage ConditionTemperatureMaximum DurationNotes
    Long-term storage-20°C to -80°C1+ yearsRequires aliquoting to avoid freeze-thaw cycles
    Working solutions4°CUp to one weekNot recommended for longer periods
    Reconstituted proteinVariableDepends on bufferUse deionized sterile water to 0.1-1.0 mg/mL

    Addition of 5-50% glycerol (final concentration) is recommended when preparing aliquots for long-term storage. The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 to maximize stability . Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided.

  • What is the functional role of Cytochrome c Oxidase Subunit 2 in honeybees?

    Cytochrome c Oxidase Subunit 2 (COII) serves several critical functions in honeybee cellular metabolism:

    1. Electron transport: COII contains the dinuclear copper A center (CuA) that receives electrons from cytochrome c in the intermembrane space of mitochondria .

    2. Oxygen reduction: As part of the cytochrome c oxidase complex (Complex IV), COII contributes to the catalytic reduction of molecular oxygen to water, the final step in the electron transport chain .

    3. Energy production: This process helps establish the electrochemical gradient that drives ATP synthesis, providing energy for cellular functions .

    4. Evolutionary marker: Beyond its metabolic role, the COII gene sequence serves as an important phylogenetic marker for understanding evolutionary relationships among Apis species, making it valuable for taxonomic and population genetic studies .

    In the broader context of honeybee biology, functional COII is essential for normal metabolic activity, particularly during energy-intensive processes such as flight and thermoregulation in the hive.

  • How do you verify the purity and integrity of recombinant COII protein?

    Multiple analytical methods should be employed to ensure the quality of recombinant COII:

    1. SDS-PAGE analysis: The primary method for purity assessment, with properly purified COII showing >90% purity as a single dominant band at the expected molecular weight .

    2. Western blot: Using antibodies specific to either COII or the His-tag to confirm protein identity.

    3. Mass spectrometry: For precise molecular weight determination and peptide mapping.

    4. Functional assays: Measuring electron transfer capability or oxygen consumption when incorporated into artificial membrane systems.

    5. Circular dichroism: To verify proper secondary structure formation.

    6. Dynamic light scattering: To assess protein homogeneity and detect potential aggregation.

    The reconstitution protocol is equally important for maintaining integrity: the lyophilized protein should be briefly centrifuged prior to opening, then reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

Advanced Research Questions

  • How can recombinant COII be used for phylogenetic studies of honeybee populations?

    Recombinant COII offers several methodological advantages for phylogenetic studies:

    1. Reference standard development: Using recombinant COII as a control in PCR-based assays targeting the COII gene region improves standardization across laboratories.

    2. Antibody production: Purified recombinant COII can be used to generate specific antibodies for protein-level detection and quantification across populations.

    3. Haplotype identification: The COII region, particularly when analyzed alongside the COI-COII intergenic region, provides high-resolution differentiation of honeybee lineages. For 100% accurate haplotype identification, the complete sequence must capture the last 62 bp of tRNA-Leu (3′end) and the first 317 bp of cytochrome oxidase II (5′end) .

    4. Population genetics applications: Analysis of COII sequences has revealed important patterns in honeybee population structure, such as declining genetic diversity along migratory routes .

    5. Evolutionary relationship mapping: Using molecular-variance parsimony techniques with COII sequence data allows researchers to compute genetic relationships between haplotypes and construct haplotype networks based on mutation steps .

    Research has demonstrated that COII sequences can be effectively compared using BLAST against verified databases, with nucleotide identity scores providing a reliable measure of phylogenetic proximity between species .

  • What are the challenges in expressing functional honeybee COII in bacterial expression systems?

    Expression of functional honeybee COII in bacterial systems presents several specific challenges:

    1. Lack of post-translational modifications: Bacterial systems cannot perform the same post-translational modifications as eukaryotic cells, potentially affecting protein function.

    2. Metal coordination issues: COII contains copper centers that require specific incorporation during folding. Studies show that recombinant structural proteins can bind heme and other metal macrocycles in a manner reminiscent of naturally occurring metalloproteins, whereby an amino acid coordinates directly to the metal center .

    3. Membrane protein expression difficulties: As a mitochondrial membrane protein, COII contains hydrophobic domains that can cause aggregation when expressed in E. coli.

    4. Stability concerns: Natural COII exists within a multi-subunit complex; isolated recombinant COII may have reduced stability. Engineering strategies using structural proteins can produce stable metalloproteins that remain functional when stored at room temperature for over one year .

    5. Codon usage bias: Differences in codon preference between honeybees and E. coli may reduce expression efficiency.

    6. Improper folding: Bacterial cytoplasm provides a different environment than the mitochondrial membrane, potentially affecting proper folding.

    7. Toxicity to host cells: If functional, the expressed protein may interfere with the host's own respiratory chain.

    A strategy to overcome these challenges involves de novo engineering of solid-state metalloproteins using recombinant coiled-coil silk, which can provide design control at four different levels: the metal center, the organic macrocycle, the protein scaffold, and the material format structure .

  • How does the structure of Apis koschevnikovi COII compare to other Apis species?

    Comparative analysis of COII across Apis species reveals important structural insights:

    SpeciesSequence Similarity to A. koschevnikoviKey Structural DifferencesEvolutionary Implications
    A. mellifera97-99% nucleotide identityMinor variations in transmembrane domainsRecent divergence
    A. cerana94-99% nucleotide identitySome variation in copper-binding regionsIntermediate relatedness
    A. dorsata97-98% nucleotide identityHighly conserved functional domainsClose phylogenetic relationship

    When comparing complete COII sequences from different Apis species, BLAST analysis shows that A. koschevnikovi COII shares high sequence identity with other honeybee species, with the highest similarity to A. mellifera (up to 99.33% identity) . This high conservation reflects the critical functional role of COII in cellular metabolism.

    Phylogenetic analysis using molecular-variance parsimony techniques on COII sequences demonstrates that structural variations in this protein can be used to track evolutionary relationships within the genus Apis . The conservation of key functional domains across species underscores the selective pressure maintaining COII's role in the electron transport chain.

  • What role does COII play in understanding evolutionary relationships among honeybee species?

    COII sequences serve as powerful molecular markers for reconstructing honeybee phylogeny through several methodological approaches:

    1. Lineage determination: Analysis of mitochondrial COII sequences, particularly when combined with COI, enables researchers to classify honeybees into evolutionary lineages. Studies have identified distinct haplotypes that correspond to geographic distributions .

    2. Migration pattern tracking: COII sequence variations have been used to trace the migration patterns of honeybee populations, revealing, for example, declining genetic diversity along migratory routes of European honeybees .

    3. Hybridization detection: COII analysis can identify hybridization events between subspecies or populations, as seen in studies of Apis mellifera subspecies .

    4. Molecular clock applications: The rate of mutation in COII provides a molecular clock that can be calibrated to estimate divergence times between species.

    5. Conservation genetics: COII analysis contributes to understanding genetic diversity in honeybee populations, which is critical for conservation efforts.

    Methodologically, researchers analyze COII sequences through multiple approaches including restriction fragment length polymorphism (RFLP) analysis with enzymes like DraI, sequence alignment and comparison, and the construction of haplotype networks to visualize genetic relationships . These analyses have revealed that honeybee COII sequences contain regions of both high conservation (reflecting functional constraints) and variable regions that are informative for phylogenetic reconstruction.

  • How can mutations in recombinant COII affect its functionality in experimental settings?

    Mutations in recombinant COII can significantly impact its biochemical properties and experimental utility:

    1. Electron transfer efficiency: Mutations in copper-binding domains can alter the redox potential and electron transfer rates. For example, studies of cytochrome c oxidase with W56R mutations showed altered enzyme activity profiles .

    2. Complex assembly: Mutations may affect the ability of COII to properly integrate into the cytochrome c oxidase complex. Research has shown that when mutant and wild-type subunits are coexpressed, they give rise to a mixed population of complexes with varying compositions .

    3. Stability changes: Some mutations can increase protein stability while others decrease it. The W56R mutation in cytochrome c oxidase subunit 2 was found to decrease the mean hydrophobicity of the first transmembrane alpha helix, altering its stability and import characteristics .

    4. Binding affinity alterations: Mutations near substrate binding sites can change binding affinities for cytochrome c or oxygen.

    5. Catalytic rate effects: Mutations in or near active sites can alter the catalytic rate of oxygen reduction.

    Experimental methods to assess these effects include in-gel activity assays, measurement of oxygen consumption rates, spectroscopic quantitation of cytochromes, and analysis of supercomplex formation through blue native polyacrylamide gel electrophoresis (BN-PAGE) . For instance, oxygen consumption measurements have shown that mutations can result in significant changes in respiratory function, with some mutants exhibiting rates less than 50% of wild-type levels.

  • What are the best methods for analyzing the interaction between recombinant COII and other components of the cytochrome c oxidase complex?

    Several sophisticated techniques can be employed to study the interactions between recombinant COII and other components of the cytochrome c oxidase complex:

    1. Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This technique allows visualization of intact protein complexes and supercomplexes. Studies have used BN-PAGE with digitonin solubilization to reveal how COII integrates into monomeric complex IV and supercomplexes (III2IV1 and III2IV2) .

    2. In-gel activity assays: These assays can specifically detect cytochrome c oxidase activity within native gels, allowing functional assessment of complexes containing recombinant COII .

    3. Oxygen consumption measurements: Polarographic measurement of oxygen uptake using substrates like ethanol can quantify the functional impact of COII integration into the complex. Wild-type complexes typically show rates around 18-19 nmol O2/min per 3×107 cells, while altered complexes may show significantly different rates .

    4. Crosslinking mass spectrometry: This approach can identify specific interaction points between COII and other subunits.

    5. Surface plasmon resonance: For measuring binding kinetics between isolated subunits.

    6. Co-immunoprecipitation: Using antibodies against the His-tag of recombinant COII to pull down interacting partners.

    7. Cryo-electron microscopy: For structural visualization of assembled complexes containing recombinant COII.

    Research has shown that when nuclear-encoded and mitochondria-encoded versions of COII are coexpressed, they give rise to a mixed population of cytochrome c oxidase complexes, with most complexes containing the mitochondria-encoded version . This observation highlights the importance of context when studying recombinant COII interactions.

  • How can recombinant COII be used as a marker for genetic diversity studies in honeybee populations?

    Recombinant COII offers multiple methodological advantages for genetic diversity research in honeybee populations:

    1. Development of standardized controls: Recombinant COII protein or its encoding DNA can serve as reference standards in PCR-based diversity studies, improving inter-laboratory comparability.

    2. Haplotype identification: The COII gene, particularly when analyzed alongside the COI-COII intergenic region, provides robust markers for honeybee lineage identification. Research has established that complete sequence capture of the intergenic region, including the last 62 bp of tRNA-Leu and first 317 bp of COII, is necessary for 100% accurate haplotype identification .

    3. Population structure analysis: COII sequence data has been used to reveal population structure patterns in honeybees. For example, studies have shown that USA honey bee populations display restrictions in their genetic diversity as revealed through mitochondrial DNA analysis .

    4. Development of specific molecular assays: Recombinant COII can facilitate the development of molecular tools like PCR-RFLP assays, with DraI restriction being particularly informative for honeybee lineage differentiation .

    5. Comparative phylogeography: COII data allows researchers to compare genetic diversity patterns across different geographic regions and correlate these with historical events or environmental factors.

    Studies have demonstrated that COII sequence analysis can effectively distinguish between honeybee subspecies with high precision, making it an invaluable tool for conservation genetics and population management . When analyzed using molecular-variance parsimony techniques, COII sequences can generate haplotype networks that visualize population relationships and evolutionary history .

  • What are the regulatory considerations when working with recombinant honeybee proteins under NIH guidelines?

    Research involving recombinant Apis koschevnikovi COII must adhere to specific regulatory frameworks:

    1. NIH Guidelines classification: Research involving recombinant COII typically falls under Section III-E or III-F of the NIH Guidelines, requiring Institutional Biosafety Committee (IBC) review and approval prior to or simultaneous with initiation .

    2. Risk assessment considerations: When submitting an IBC protocol, the principal investigator must:

      • Make an initial determination of required physical and biological containment levels

      • Select appropriate microbiological practices and laboratory techniques

      • Submit the initial research protocol and any subsequent changes for review

    3. Documentation requirements: The research proposal must specify:

      • The source of DNA (Apis koschevnikovi)

      • The host-vector system (typically E. coli with commercial expression vectors)

      • Containment facilities and procedures to be employed

    4. Biosafety levels: Work with recombinant COII typically requires Biosafety Level 1 (BSL-1) practices, but this assessment should be confirmed by the IBC.

    5. Personnel requirements: The principal investigator should identify all project personnel involved in the administration of recombinant material, with appropriate training documented .

    6. Institutional oversight: The institution is responsible for ensuring that all recombinant DNA research conducted complies with the NIH Guidelines, with the IBC serving as the primary oversight body .

    The NIH Guidelines define recombinant nucleic acids as "molecules that are constructed by joining nucleic acid molecules and that can replicate in a living cell," a definition that encompasses the cloning and expression of Apis koschevnikovi COII in bacterial systems .

  • How do recombination rates in honeybees affect COII evolution and genetic diversity?

    Honeybees exhibit exceptionally high meiotic recombination rates that significantly impact COII evolution:

    1. Elevated recombination in Apis mellifera: Genome-wide recombination rates in honeybees are approximately 20-38 cM/Mb, which is 10-fold higher than in Drosophila and several-fold higher than in any other higher eukaryote .

    2. Relationship with GC content: High recombination rates in honeybees are associated with heterogeneous GC content. Local recombination rates correlate positively with GC content in the AT-rich Apis mellifera genome, suggesting biased gene conversion processes .

    3. Impact on mitochondrial genes: While direct recombination doesn't occur in mitochondrial genes like COII, nuclear recombination affects the evolutionary trajectory of nuclear genes that interact with COII and other mitochondrial proteins.

    4. Recombination variability: Studies have revealed considerable differences in the genome-wide rates and distribution of meiotic crossovers among different honeybee populations, with variation unrelated to geographic or phylogenetic distance .

    5. Evolutionary implications: The high recombination rates in honeybees may contribute to increased genetic diversity, potentially enhancing adaptation and evolution of worker traits. Genes associated with behavior and those with worker-biased expression are often found in GC-rich, high-recombination regions of the genome .

    Research has shown that GC-rich genes and intergenic regions in honeybees have higher levels of genetic diversity and divergence relative to GC-poor regions, consistent with recombination's causal influence on the rate of molecular evolution . This process may indirectly influence the evolution of nuclear genes that interact with mitochondrial genes like COII, potentially affecting co-adaptation between nuclear and mitochondrial genomes.

  • What experimental approaches are used to study the functional properties of recombinant COII in vitro?

    Several sophisticated experimental approaches can characterize recombinant COII function:

    1. Reconstitution into proteoliposomes: Recombinant COII can be incorporated into artificial lipid membranes to study its function in a controlled environment.

    2. Polarography: Oxygen consumption measurements using Clark-type electrodes provide quantitative data on the catalytic activity of reconstituted cytochrome c oxidase complexes containing recombinant COII. Studies have demonstrated that wild-type complexes typically show oxygen uptake rates of approximately 18-19 nmol O2/min per 3×107 cells .

    3. Spectroscopic analysis: UV-visible and infrared spectroscopy can track changes in the redox state of metal centers and measure binding of ligands like CO and cyanide.

    4. In-gel activity assays: Activity staining of native gels allows visualization of functional cytochrome c oxidase complexes containing recombinant COII. This technique has been used to visualize monomeric complex IV, complex IV lacking Cox6 subunit (IV*), and supercomplexes (III2IV1 and III2IV2) .

    5. Electron paramagnetic resonance (EPR): This technique can provide detailed information about the electronic structure of the copper centers in COII.

    6. Stopped-flow kinetics: For measuring the rates of electron transfer in reconstituted systems.

    7. Thermal stability assays: Differential scanning calorimetry or fluorescence-based thermal shift assays can evaluate the stability of recombinant COII under various conditions.

    8. Binding assays: Surface plasmon resonance or isothermal titration calorimetry can measure binding between recombinant COII and its interaction partners.

    Research has shown that mutations in COII can significantly impact these functional properties. For example, the W56R mutation, which decreases the mean hydrophobicity of the first transmembrane segment, affects protein import into mitochondria but does not necessarily impair cytochrome c oxidase activity when properly assembled .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.