Recombinant Apis mellifera ligustica ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Apis mellifera ligustica ATP synthase subunit a (ATP6)

Recombinant Apis mellifera ligustica ATP synthase subunit a (ATP6) is a protein derived from the Italian honeybee (Apis mellifera ligustica), a subspecies of the Western honeybee widely used in apiculture worldwide. ATP synthase subunit a, also known as F-ATPase protein 6, is an essential component of the mitochondrial ATP synthase complex, which plays a critical role in ATP production during oxidative phosphorylation . This complex is often described as a double-motor enzyme that participates not only in ATP synthesis but also in other cellular functions .

The recombinant form of ATP6 protein is produced through genetic engineering techniques, typically in bacterial expression systems like Escherichia coli, to facilitate scientific research and various biotechnological applications. The protein is encoded by the ATP6 gene located in the mitochondrial genome, and in its recombinant form, it is typically tagged (often with histidine) to enable efficient purification and downstream applications .

Production and Expression Systems

The production of Recombinant Apis mellifera ligustica ATP synthase subunit a (ATP6) primarily utilizes Escherichia coli as the expression host, leveraging this bacterial system's advantages of rapid growth, high protein yields, and cost-effectiveness . The recombinant protein production process involves several sophisticated steps that ensure the generation of high-quality protein suitable for research applications.

Initially, the ATP6 gene sequence is isolated from Apis mellifera ligustica mitochondrial DNA and then cloned into an appropriate expression vector containing the necessary regulatory elements and affinity tag sequences. This genetic construct is subsequently transformed into competent E. coli cells for protein expression. Following bacterial culture under optimized conditions and induction of protein expression, the bacterial cells are harvested and lysed to release the recombinant protein.

The His-tagged ATP6 protein is then purified using affinity chromatography, typically employing nickel or cobalt resins that selectively bind the histidine residues in the affinity tag. After purification, the protein undergoes quality control assessments, including SDS-PAGE analysis to verify its purity, which is typically greater than 90% for commercial preparations .

The final product is formulated in a suitable buffer system, such as Tris/PBS-based buffer with 6% trehalose (pH 8.0) or a Tris-based buffer with 50% glycerol , depending on the manufacturer's specific protocols. These formulations are designed to maximize protein stability and functionality during storage. The protein solution is then lyophilized to enhance long-term stability and facilitate transportation.

Applications and Research Uses

Recombinant Apis mellifera ligustica ATP synthase subunit a (ATP6) has multiple applications in scientific research, particularly in studies related to honey bee biology, bioenergetics, and responses to environmental stressors.

Antibody Production and Immunological Applications

The recombinant ATP6 protein serves as a valuable antigen for producing specific antibodies, which can subsequently be used in various immunological techniques including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA) . These antibodies facilitate the detection and quantification of native ATP6 in honey bee tissues, enabling studies on protein expression patterns under different physiological conditions or in response to environmental challenges.

Mitochondrial Function and Bioenergetics Research

As a component of ATP synthase, recombinant ATP6 plays a central role in studies examining mitochondrial function and energy metabolism in honey bees. Research has shown that honey bee energy production can be affected by various factors, including exposure to pesticides and fungicides, which can disrupt the metabolism of dietary compounds like quercetin . Studies utilizing recombinant ATP6 can help elucidate the molecular mechanisms underlying these effects and their implications for honey bee health.

Evolutionary and Comparative Studies

The availability of recombinant ATP6 from Apis mellifera ligustica facilitates comparative analyses across different bee species or even broader taxonomic groups. Such studies contribute to our understanding of evolutionary conservation and divergence in energy metabolism pathways. Research on honey bee populations has revealed significant genetic adaptations in response to introduced diseases, suggesting complex mechanisms of rapid tolerance evolution while maintaining genetic diversity . Comparative studies of ATP6 and other mitochondrial proteins may provide insights into these adaptive processes.

Reconstitution Procedures

Prior to reconstitution, the vial containing lyophilized protein should be briefly centrifuged to bring the contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For optimal stability after reconstitution, it is recommended to add glycerol to a final concentration of 5-50% and aliquot the solution for long-term storage at -20°C or -80°C .

ATP synthase subunit a (ATP6) performs a crucial role in cellular energy metabolism in Apis mellifera ligustica, as it does in other organisms. As an integral component of the ATP synthase complex (Complex V of the respiratory chain), ATP6 is essential to the process of oxidative phosphorylation, which represents the primary pathway for ATP production in eukaryotic cells .

Role in Mitochondrial Energy Production

The ATP synthase complex functions as a sophisticated molecular motor, utilizing the proton gradient across the inner mitochondrial membrane to drive the synthesis of ATP from ADP and inorganic phosphate. ATP6, as part of the membrane-embedded Fo portion of the complex, forms a critical component of the proton channel through which hydrogen ions flow back into the mitochondrial matrix . This proton movement generates the rotational motion of the enzyme's central stalk, which in turn catalyzes ATP synthesis in the F1 portion of the complex.

In honey bees, efficient energy production is particularly important due to their high metabolic demands, especially during flight, which represents one of the most energetically expensive activities in the animal kingdom. The ATP synthase complex, including ATP6, thus plays a vital role in supporting these energy-intensive activities that are essential for honey bee survival and colony function.

Potential Involvement in Stress Responses

While specific information on ATP6 interactions with environmental stressors is limited in the provided search results, research on honey bee populations has demonstrated remarkable resilience and adaptive capacity in response to introduced diseases . Studies have shown that genetically diverse honey bee populations can recover from introduced diseases by evolving rapid tolerance while maintaining much of their standing genetic variation . The mechanisms underlying these adaptive responses likely involve complex interactions at multiple biological levels, potentially including adjustments in energy metabolism that may involve ATP synthase function.

Research Findings and Future Perspectives

Current research involving Apis mellifera ligustica ATP synthase components reveals several important findings and points to promising directions for future investigations.

Metabolic Adaptations and Environmental Challenges

Recent studies have examined how honey bees respond metabolically to various environmental challenges, including exposure to pathogens like Ascosphaera apis and the ectoparasitic mite Varroa destructor . While these studies do not explicitly focus on ATP6, they highlight the importance of understanding honey bee molecular responses to stressors, which likely involve adjustments in energy metabolism. Research has shown that despite massive colony mortality following the introduction of Varroa destructor, nuclear genetic diversity was maintained in wild honey bee populations, suggesting complex adaptive mechanisms .

Interactions with Phytochemicals and Xenobiotics

Studies have demonstrated that honey bees efficiently uptake and metabolize dietary phytochemicals, with research showing ample gut uptake and metabolization of various compounds . Cytochrome P450 monooxygenases in honey bees detoxify phytochemicals in honey and pollen, and certain compounds like quercetin can act as transcriptional regulators of mitochondrion-related nuclear genes and genes encoding subunits of complexes in the oxidative phosphorylation pathway . These findings suggest potential interactions between dietary compounds and energy metabolism in honey bees, which may involve ATP synthase components like ATP6.

Future Research Directions

Several promising avenues for future research on Recombinant Apis mellifera ligustica ATP synthase subunit a (ATP6) emerge from current findings:

  1. Detailed structural studies using advanced techniques like cryo-electron microscopy to elucidate the precise three-dimensional conformation of ATP6 within the ATP synthase complex.

  2. Functional characterization of ATP6 under various stress conditions relevant to honey bee health, including exposure to pesticides, pathogens, and nutritional stress.

  3. Investigation of potential interactions between ATP6 and phytochemicals or xenobiotics commonly encountered by honey bees, and their implications for energy metabolism.

  4. Comparative analyses of ATP6 structure and function across different honey bee subspecies and related bee species to identify evolutionary adaptations in energy metabolism.

  5. Development of potential interventions targeting energy metabolism to enhance honey bee resilience against environmental stressors.

Research AreaKey FindingsFuture Directions
Structural BiologyATP6 consists of 226 amino acids with multiple transmembrane domainsAdvanced structural characterization using cryo-EM or X-ray crystallography
Metabolic ResponsesHoney bees show complex metabolic adaptations to environmental challengesInvestigate specific roles of ATP synthase components in these responses
Phytochemical InteractionsDietary compounds can influence gene expression related to mitochondrial functionExamine direct interactions between phytochemicals and ATP6
Population GeneticsHoney bee populations maintain genetic diversity despite disease challengesExplore potential variations in ATP6 and their functional implications
Mitochondrial FunctionATP synthase plays crucial roles beyond ATP synthesisCharacterize novel functions of ATP6 in honey bee physiology

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your application.
Shelf Life
Shelf life is influenced by various factors such as storage state, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Apis mellifera ligustica (Common honeybee) (Italian honeybee)
Target Names
ATP6
Target Protein Sequence
MKLILMMNLFEMFDPSTSNNLSMNWLFMMLPIIIFPSIFWLIQSRIMFIMKTLMNFMYNE FKVVSKSKYQSNIIIFISLMLYIMITNIFSLIPYVFTLTSHLLLNMILSLTLWFSFLIYL IYNNYIMFLSHLVPLNSPVFLMNFMVIIELISLIIRPWTLSIRLSANLISGHLILTLLGI FISNFISILPINLMIQNMLLTLEIFMSMIQSYVFSILLILYFSESN
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) synthesizes ATP from ADP in the presence of a proton gradient across the membrane, which is generated by electron transport complexes of the respiratory chain. F-type ATPases are composed of two structural domains: F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism of the central stalk subunits. ATP synthase subunit a is a key component of the proton channel and may play a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the ATP synthase subunit a (ATP6) in Apis mellifera ligustica and what is its primary function?

ATP synthase subunit a, also known as F-ATPase protein 6, is a critical transmembrane protein component of mitochondrial ATP synthase (Complex V). In Apis mellifera ligustica (Italian honeybee), this protein is encoded by the mitochondrial ATP6 gene and constitutes part of the Fo domain located in the inner mitochondrial membrane .

The protein functions within the larger ATP synthase complex to facilitate proton translocation across the inner mitochondrial membrane. This proton movement is essential for the conversion of the proton electrochemical gradient into mechanical energy that drives ATP synthesis. Specifically, ATP6 forms part of the proton channel that allows H+ ions to flow through the membrane, ultimately enabling the phosphorylation of ADP to ATP in the F1 domain . This process is fundamental to cellular energy production in the honeybee.

What expression systems are most effective for producing recombinant Apis mellifera ATP6?

The most effective and commonly used expression system for producing recombinant Apis mellifera ligustica ATP6 is an in vitro E. coli expression system . This approach offers several advantages for the production of this transmembrane protein:

  • Scalability: E. coli systems allow for efficient production at various scales, from small laboratory preparations to larger amounts needed for structural studies.

  • Codon optimization: When expressing insect proteins in bacterial systems, codon optimization can significantly improve yield by adjusting the codon usage to match the preferred codons of E. coli.

  • Tag incorporation: The system facilitates the incorporation of purification tags, such as the N-terminal 10xHis-tag commonly used with recombinant ATP6 .

For researchers working with this protein, it's important to note that alternative eukaryotic expression systems may be considered if post-translational modifications are critical to the research question, though the available data indicates successful production in bacterial systems.

What are the optimal storage conditions for maintaining the stability of recombinant ATP6?

For optimal stability of recombinant Apis mellifera ligustica ATP6, the following storage conditions are recommended:

  • Short-term storage: Store working aliquots at 4°C for up to one week .

  • Medium-term storage: Store at -20°C for up to 6 months (for liquid formulations) .

  • Long-term storage: For extended preservation, store at -20°C or preferably -80°C. The shelf life of lyophilized formulations can extend to 12 months at these temperatures .

Critical considerations for maintaining protein stability include:

  • Avoiding repeated freeze-thaw cycles, which can lead to protein denaturation and reduced activity .

  • Using appropriate buffer conditions that maintain protein structure and function.

  • Aliquoting the protein into single-use volumes to minimize freeze-thaw cycles.

  • Including stabilizing agents such as glycerol in storage buffers when appropriate.

What analytical techniques are most effective for studying the structure-function relationship of ATP6?

Several analytical techniques have proven valuable for investigating the structure-function relationship of ATP6:

  • X-ray Crystallography: Although challenging for membrane proteins, this technique has been successfully applied to ATP synthase subunits to resolve detailed structural information . For ATP6 specifically, this approach can reveal the arrangement of transmembrane helices and interaction sites.

  • Mitochondrial Membrane Potential Measurement: This technique is particularly relevant as pathogenic variants in ATP6 can lead to either increased or decreased mitochondrial membrane potential . Methods include:

    • Fluorescent dye-based approaches (e.g., JC-1, TMRM)

    • Potentiometric probes

    • Patch-clamp electrophysiology

  • ATP Synthesis Assays: Measuring ATP synthesis rates is crucial for functional studies of ATP6 variants . These assays typically involve:

    • Luminescence-based ATP quantification

    • Enzyme-coupled spectrophotometric assays

    • Radioisotope incorporation methods

  • Proton Flux Measurements: Since ATP6 forms part of the proton channel, techniques that quantify proton translocation provide direct functional data:

    • pH-sensitive fluorescent probes

    • Reconstitution in liposomes with pH indicators

  • Protein-Protein Interaction Studies: To understand how ATP6 interacts with other components of the ATP synthase complex:

    • Cross-linking coupled with mass spectrometry

    • Blue native gel electrophoresis

    • Co-immunoprecipitation assays

How can researchers effectively measure ATP synthase activity in systems containing recombinant ATP6?

Measuring ATP synthase activity in systems with recombinant ATP6 requires approaches that can distinguish between ATP synthesis and hydrolysis functions:

  • ATP Synthesis Rate Measurement:

    • Reconstitute ATP synthase containing recombinant ATP6 in liposomes with an artificially generated proton gradient

    • Measure ATP production over time using luciferase-based assays or other ATP detection methods

    • Compare synthesis rates between wild-type and variant forms of ATP6

  • ATP Hydrolysis Assays:

    • Spectrophotometric assays coupling ADP production to NADH oxidation

    • Measurement of inorganic phosphate release

    • These assays are important as ATP hydrolysis capacity is often preserved even when ATP synthesis is compromised by ATP6 mutations

  • Oligomycin Sensitivity Testing:

    • Oligomycin binds to subunits a (ATP6) and c, inhibiting proton translocation

    • Measuring the impact of oligomycin on ATP synthesis or hydrolysis provides information about the integrity of the proton channel

    • Changes in oligomycin sensitivity can indicate structural alterations in ATP6

  • Proton Pumping Efficiency Assessment:

    • Monitor proton movement using pH-sensitive dyes or electrodes

    • Compare the ATP synthesis rate to proton translocation ratio

    • This is particularly relevant as impaired proton pumping efficiency has been observed with certain ATP6 variants

How can ATP6 be used for phylogenetic studies in Apis species and other insects?

ATP6 serves as a valuable molecular marker for phylogenetic studies in Apis species and other insects due to several key characteristics:

  • Conservation and Variability Patterns: The ATP6 gene contains both conserved regions (for designing universal primers) and variable regions (for distinguishing between closely related species) . This makes it particularly useful for studies at various taxonomic levels.

  • Restriction Fragment Length Polymorphism (RFLP) Analysis:

    • PCR amplification of ATP6, followed by digestion with restriction enzymes

    • The resulting restriction patterns can be used to differentiate between subspecies, as demonstrated in studies of Melipona quadrifasciata subspecies

    • Especially effective with 4-base cutter enzymes, which have revealed polymorphic sites between closely related taxa

  • Sequence-Based Phylogenetic Analysis:

    • Complete sequencing of the ATP6 gene provides data for constructing phylogenetic trees

    • Analysis of synonymous vs. non-synonymous substitutions can reveal selection pressures

    • Comparison of ATP6 sequences across species helps establish evolutionary relationships

  • Heteroplasmy Analysis:

    • Mitochondrial DNA, including ATP6, can exist in multiple variants within a single individual (heteroplasmy)

    • The degree of heteroplasmy and the specific variants present can be informative for population studies

    • When combined with geographic data, this can reveal patterns of population structure and gene flow

What are the significant evolutionary differences between Apis mellifera ATP6 and ATP6 in other species?

Several notable evolutionary differences distinguish Apis mellifera ATP6 from its counterparts in other species:

  • A+T Content:

    • The mitochondrial genome of Apis mellifera and other insects shows a strong A+T bias

    • Interestingly, comparisons between Apis mellifera and Melipona bicolor (a stingless bee) have shown that M. bicolor has an even higher A+T content (86.7% compared to 84.3% in A. mellifera)

    • This extreme A+T bias affects codon usage and may have implications for recombinant expression systems

  • Intergenic Regions:

    • A notable evolutionary feature in Apis mellifera is the presence of an intergenic region between COI-COII genes

    • This region is absent in Meliponini bees, which represents a significant structural difference in mitochondrial genome organization

    • In other Apis species (A. cerana, A. dorsata, and A. florea), this region exists but is shorter due to having undergone fewer duplications compared to A. mellifera

  • Genomic Size Variations:

    • The total mitochondrial genome size varies significantly between bee species

    • For example, Meliponini mitochondrial genomes are estimated to be approximately 18,500 bp, which is about 2,200 bp larger than in Apis mellifera

    • These size differences primarily reside in the A+T rich control region

  • Conservation of Functional Domains:

    • Despite sequence divergence, the functional domains of ATP6 that are critical for proton translocation show greater conservation across species

    • Regions under severe functional constraints exhibit fewer polymorphisms compared to regions under less severe constraints

How do mutations in ATP6 affect ATP synthase function, and what experimental approaches can detect these changes?

Mutations in ATP6 can significantly alter ATP synthase function through various mechanisms, with distinct experimental approaches available to detect and characterize these changes:

  • Effects on ATP Synthesis:

    • Many pathogenic ATP6 variants result in reduced ATP synthesis rates while preserving ATP hydrolysis capacity

    • Experimental detection: Luciferase-based ATP production assays comparing wild-type and mutant ATP6 variants in reconstituted systems or cellular models

  • Alterations in Mitochondrial Membrane Potential:

    • Mutations can lead to either abnormally increased or decreased mitochondrial membrane potential

    • For example, the m.8993T>G variant typically causes increased membrane potential, suggesting impaired proton flow through the pore

    • The m.9185T>C variant often results in decreased membrane potential, indicating unregulated proton release

    • Detection methods: Fluorescent dyes such as TMRM, JC-1, or Rhodamine 123 that respond to membrane potential changes

  • Impacts on Complex Assembly:

    • Some mutations affect the assembly of the complete ATP synthase holoenzyme

    • Detection approach: Blue native polyacrylamide gel electrophoresis (BN-PAGE) to visualize intact complexes and assembly intermediates

  • Changes in Proton Pumping Efficiency:

    • Certain mutations specifically impair the efficiency of proton pumping without completely abolishing function

    • Measurement techniques: Simultaneous monitoring of proton translocation and ATP synthesis rates to calculate pumping efficiency

  • Altered Sensitivity to Inhibitors:

    • Changes in response to oligomycin, a specific inhibitor that binds to ATP6 and subunit c

    • Detection method: Dose-response curves measuring ATP synthesis or hydrolysis in the presence of varying oligomycin concentrations

MutationPrimary Functional EffectsDetection MethodsProposed Mechanism
m.8993T>GDecreased ATP synthesis, Increased mitochondrial membrane potentialATP synthesis assays, Membrane potential measurementsImpaired proton flow through proton pore
m.9185T>CDecreased mitochondrial membrane potential, Impaired CV holoenzyme assemblyMembrane potential measurements, BN-PAGEUnregulated proton release through proton pore

What biochemical features distinguish different ATP6 variants, and how can these be leveraged in research?

Different ATP6 variants exhibit distinct biochemical features that can be leveraged in various research contexts:

  • Differential Effects on ATP Synthesis vs. Hydrolysis:

    • Most pathogenic ATP6 variants show reduced ATP synthesis while maintaining normal ATP hydrolysis capacity

    • This biochemical distinction is valuable for:

      • Screening potential therapeutic compounds that specifically enhance ATP synthesis

      • Studying the mechanistic differences between the forward (synthesis) and reverse (hydrolysis) reactions

      • Investigating the proton-coupling mechanism independent of catalytic site function

  • Variant-Specific Changes in Membrane Potential:

    • The directionality of membrane potential changes varies by mutation:

      • Some variants like m.8993T>G lead to increased potential

      • Others like m.9185T>C cause decreased potential

    • Research applications:

      • Probing the structure-function relationship of different regions within ATP6

      • Developing variant-specific therapeutic approaches

      • Creating models to study mitochondrial diseases with different bioenergetic profiles

  • Effects on Holocomplex Assembly:

    • Variants differ in their impact on ATP synthase assembly:

      • Some primarily affect proton pumping with normal assembly

      • Others show impaired complex assembly

    • Research utility:

      • Investigating assembly pathways of ATP synthase

      • Studying compensatory mechanisms in cells with assembly defects

      • Identifying potential assembly factors through interaction studies

  • Oligomycin Response Profiles:

    • ATP6 variants can show normal, increased, or decreased sensitivity to oligomycin

    • Applications in research:

      • Using oligomycin as a probe to assess structural integrity of the proton channel

      • Developing assays to screen for compounds that can restore normal oligomycin sensitivity

      • Studying the binding interface between ATP6 and inhibitory molecules

How can researchers effectively incorporate recombinant ATP6 into liposome systems for functional studies?

Incorporating recombinant ATP6 into liposome systems requires careful consideration of several factors to ensure functional reconstitution:

  • Liposome Preparation Protocol:

    • Select lipid composition mimicking the inner mitochondrial membrane (phosphatidylcholine, phosphatidylethanolamine, cardiolipin)

    • Prepare liposomes using techniques such as extrusion or sonication to create unilamellar vesicles of appropriate size (typically 100-200 nm)

    • Include pH indicators within liposomes if proton translocation studies are planned

  • Protein Incorporation Methods:

    • Detergent-mediated reconstitution: Solubilize recombinant ATP6 in mild detergents (e.g., DDM, CHAPS), mix with destabilized liposomes, then remove detergent via dialysis or Bio-Beads

    • Direct incorporation during liposome formation for hydrophobic proteins

    • Consider co-reconstitution with other ATP synthase subunits for full functional studies

  • Orientation Control:

    • ATP6 must be incorporated with the correct orientation to function properly

    • Assess protein orientation using protease protection assays or antibody-based techniques

    • Aim for uniform orientation to simplify interpretation of functional data

  • Functional Validation Approaches:

    • Proton translocation assays using pH-sensitive fluorescent dyes

    • ATP synthesis measurements when co-reconstituted with other ATP synthase components

    • Membrane potential generation using potentiometric dyes

    • Structural integrity assessment via freeze-fracture electron microscopy

  • Experimental Controls:

    • Empty liposomes to establish baseline measurements

    • Liposomes with known ATP6 variants as positive and negative controls

    • Oligomycin inhibition tests to confirm specific ATP6-related activity

What approaches can be used to study the interaction between ATP6 and other subunits of the ATP synthase complex?

Studying the interactions between ATP6 and other ATP synthase subunits requires specialized techniques suitable for membrane protein complexes:

  • Cross-linking Coupled with Mass Spectrometry:

    • Apply chemical cross-linkers to stabilize transient interactions

    • Digest the cross-linked complex and analyze by mass spectrometry

    • Identify cross-linked peptides to map interaction interfaces

    • Advantages: Provides specific residue-level interaction data; can detect transient interactions

  • Site-Directed Mutagenesis and Functional Assays:

    • Introduce mutations at predicted interaction sites in ATP6

    • Assess the impact on assembly and function of the ATP synthase complex

    • Perform rescue experiments to confirm specificity

    • Benefits: Directly tests the functional importance of specific interactions

  • Blue Native PAGE and Co-Immunoprecipitation:

    • Preserve native protein interactions during sample preparation

    • Visualize intact complexes and subcomplexes containing ATP6

    • Identify interacting partners via Western blot or mass spectrometry

    • Advantages: Maintains physiological interactions; can detect multiple interaction partners

  • Structural Biology Approaches:

    • Cryo-electron microscopy of intact ATP synthase complexes

    • X-ray crystallography of ATP6 in complex with interacting subunits

    • NMR studies of smaller interacting domains

    • Benefits: Provides detailed structural information about interaction interfaces

  • Computational Prediction and Modeling:

    • Molecular dynamics simulations to predict stable interaction conformations

    • Molecular docking to identify potential binding sites

    • Evolutionary coupling analysis to identify co-evolving residues likely to interact

    • Advantages: Can guide experimental design; useful when experimental structures are unavailable

What are the promising areas for future research involving recombinant Apis mellifera ATP6?

Several promising research directions for recombinant Apis mellifera ATP6 include:

  • Comparative Studies with Human ATP6:

    • Investigate functional conservation between insect and human ATP6

    • Explore whether insights from Apis mellifera ATP6 can inform understanding of human mitochondrial diseases

    • Assess the potential of the honeybee model for studying ATP synthase function and pathology

  • Climate Change and Environmental Stress Response:

    • Examine how environmental stressors affect ATP6 function in honeybees

    • Investigate whether ATP6 variants confer differential resilience to temperature fluctuations

    • Study the energetic consequences of environmental stress at the molecular level

  • Structural Biology Advancements:

    • Apply emerging cryo-EM techniques to resolve the structure of Apis mellifera ATP synthase

    • Compare structural features with those of other species' ATP synthases

    • Identify unique structural adaptations that may relate to the honeybee's physiological requirements

  • Phylogenetic and Population Genetics Applications:

    • Develop ATP6-based markers for monitoring honeybee population genetics

    • Use ATP6 sequence variation to track evolutionary relationships among Apis species

    • Create improved tools for identifying subspecies and lineages in conservation efforts

  • Drug Discovery Platform:

    • Use recombinant ATP6 to screen for compounds that modulate ATP synthase activity

    • Identify molecules that could protect against mitochondrial dysfunction

    • Explore applications in both apiculture and biomedical research

How might advances in ATP6 research contribute to understanding broader questions in mitochondrial biology?

Research on ATP6 has significant potential to advance our understanding of fundamental questions in mitochondrial biology:

  • Mitochondrial Evolution and Adaptation:

    • ATP6 sequence and functional studies can illuminate adaptive changes in energy metabolism across species

    • The extreme A+T bias observed in insect mitochondrial genomes, particularly in Apis mellifera and even more so in Melipona bicolor , raises questions about selection pressures and functional constraints

    • Comparative analyses can reveal how ATP synthase structure and function have evolved in different ecological niches

  • Mitochondrial Disease Mechanisms:

    • Studies of ATP6 variants provide insights into how mitochondrial mutations affect bioenergetics

    • The varied biochemical consequences of different ATP6 mutations suggest complex structure-function relationships that may be relevant to human mitochondrial disorders

    • Understanding the mechanistic details of how ATP6 variants affect proton pumping and ATP synthesis can inform therapeutic approaches

  • Mitochondrial Quality Control Systems:

    • Research on ATP6 incorporation into the ATP synthase complex can shed light on mitochondrial quality control mechanisms

    • How cells detect and respond to dysfunctional ATP6 may reveal broader principles of mitochondrial homeostasis

    • This research may uncover novel mitochondrial stress response pathways

  • Bioenergetic Adaptation:

    • Investigating how different ATP6 variants affect the efficiency of ATP production can provide insights into metabolic adaptation

    • Understanding the balance between ATP synthesis rate and proton leak may reveal important principles about energy efficiency trade-offs

    • This research has implications for understanding cellular responses to varying energy demands

  • Mitochondrial-Nuclear Communication:

    • Since ATP6 is mitochondrially encoded but functions in a complex with nuclear-encoded subunits, it provides an excellent model for studying mitonuclear coordination

    • Research into how cells ensure proper stoichiometry and assembly of the ATP synthase complex can reveal principles of organellar-nuclear communication

    • This has broader implications for understanding evolutionary constraints on organellar genomes

By addressing these questions, ATP6 research extends beyond a single protein to inform our understanding of fundamental aspects of mitochondrial biology, bioenergetics, and cellular homeostasis.

What are the optimal experimental conditions for measuring ATP6-dependent activities in vitro?

To achieve reliable and reproducible measurements of ATP6-dependent activities in vitro, researchers should consider the following optimal conditions:

  • Buffer Composition:

    • pH: Maintain pH 7.2-7.5 to mimic physiological conditions

    • Ionic strength: 100-150 mM KCl or NaCl

    • Divalent cations: 2-5 mM Mg²⁺ as a cofactor for ATP synthesis/hydrolysis

    • Include 2-5 mM inorganic phosphate for ATP synthesis assays

  • Temperature Considerations:

    • For Apis mellifera proteins, 30-35°C often provides optimal activity

    • Temperature control must be precise (±0.1°C) as ATP synthase activity is highly temperature-sensitive

    • Include temperature controls in experimental design when comparing variants

  • Membrane Environment:

    • For reconstituted systems, lipid composition significantly affects ATP6 function

    • Include cardiolipin (15-20% of total lipids) as it's essential for optimal ATP synthase activity

    • Maintain a protein:lipid ratio of approximately 1:50 to 1:100 (w/w)

  • Substrate Concentrations:

    • ATP synthesis: 1-2 mM ADP, 5-10 mM Pi

    • ATP hydrolysis: 1-5 mM ATP

    • Ensure substrate concentrations are saturating to measure maximal activity

  • Proton Gradient Parameters:

    • For ATP synthesis assays, establish a ΔpH of 2-3 units across the membrane

    • For comprehensive bioenergetic assessment, control both ΔpH and Δψ components

    • Artificial gradient generation: acid-base transition or K⁺/valinomycin systems

  • Detection Systems:

    • ATP synthesis: Luciferase-based detection (sensitivity to nanomolar range)

    • ATP hydrolysis: Linked enzyme assays (e.g., pyruvate kinase/lactate dehydrogenase system)

    • Proton translocation: pH-sensitive fluorescent dyes (e.g., ACMA, pyranine)

  • Critical Controls:

    • Oligomycin inhibition (1-5 μg/ml) to confirm ATP6-specific activity

    • Uncoupler controls (e.g., FCCP, 0.5-1 μM) to collapse proton gradients

    • No-substrate controls to establish baseline signals

What are the key challenges in working with recombinant ATP6 and how can they be addressed?

Working with recombinant ATP6 presents several challenges that require specific technical solutions:

  • Expression and Purification Challenges:

    • Challenge: As a hydrophobic membrane protein, ATP6 can form inclusion bodies in bacterial expression systems

    • Solutions:

      • Use specialized E. coli strains (C41(DE3), C43(DE3)) designed for membrane protein expression

      • Include solubilizing tags (e.g., the 10xHis-tag used in commercial preparations)

      • Express at lower temperatures (16-20°C) to slow folding and improve solubility

      • Consider cell-free expression systems for difficult constructs

  • Protein Stability Issues:

    • Challenge: ATP6 may denature during purification and storage

    • Solutions:

      • Use mild detergents (DDM, LMNG) for extraction and purification

      • Include stabilizing additives like glycerol (10-15%) and reducing agents

      • Minimize freeze-thaw cycles by creating single-use aliquots

      • For long-term storage, lyophilization may be preferred over liquid storage

  • Functional Reconstitution Difficulties:

    • Challenge: Ensuring proper folding and orientation in artificial membrane systems

    • Solutions:

      • Optimize detergent removal rate during reconstitution

      • Include other ATP synthase subunits to stabilize ATP6

      • Use native-like lipid compositions

      • Verify protein incorporation and orientation using biochemical and microscopy techniques

  • Activity Measurement Complications:

    • Challenge: Distinguishing ATP6-specific effects from background activities

    • Solutions:

      • Design experiments with appropriate negative controls (e.g., liposomes without protein)

      • Include oligomycin controls to confirm ATP6-dependent activity

      • Perform parallel experiments with known ATP6 variants for comparison

      • Use multiple complementary assays to validate findings

  • Heterologous System Limitations:

    • Challenge: E. coli-expressed ATP6 may lack post-translational modifications

    • Solutions:

      • Compare with native ATP6 isolated from Apis mellifera mitochondria

      • Consider insect cell expression systems for critical applications

      • Evaluate functional impacts of potential modifications using site-directed mutagenesis

By implementing these technical solutions, researchers can overcome the inherent challenges of working with recombinant ATP6 and generate reliable experimental data for addressing fundamental questions in mitochondrial biology and ATP synthase function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.