Recombinant Apis mellifera ligustica Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Apis mellifera ligustica (Common honeybee) (Italian honeybee)
Target Names
COII
Target Protein Sequence
MSTWFMFMFQESNSYYADNLISFHNMVMMIIIMISTLTVYIILDLFMNKFSNLFLLKNHN IEIIWTIIPIIILLIICFPSLKILYLIDEIVNPFFSIKSIGHQWYWSYEYPEFNNIEFDS YMLNYNNLNQFRLLETDNRMVIPMKIPLRLITTSTDVIHSWTVPSLGIKVDAVPGRINQL NLISKRPGIFFGQCSEICGMNHSFMPIMIESTSFQYFLNWVNKQI
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis via ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred via the CuA center (subunit 2) and heme a (subunit 1) to the binuclear active site (subunit 1), comprising heme a3 and CuB. This binuclear center utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the significance of the COI-COII region in Apis mellifera ligustica mitochondrial DNA?

The COI-COII intergenic region serves as a crucial marker for determining honey bee evolutionary lineages and population genetics. This non-coding region between cytochrome c oxidase subunits I and II reflects the genetic evolution and diversity of Apis mellifera subspecies. The restriction patterns observed in this region, particularly using the DraI restriction enzyme (DmCC test), enable researchers to distinguish between different mitochondrial lineages (A, M, C) and identify specific haplotypes within these lineages .

In A. mellifera ligustica, this region typically displays characteristic C-lineage patterns, though studies have revealed a composite structure of both European lineages (M and C) in Italian peninsula populations. This hybrid origin was previously obscured because samples from the main queen production areas contained only C-lineage mitotypes, while the M lineage appears elsewhere in Italy .

Methodological approach:
To analyze this region, researchers should:

  • Extract mitochondrial DNA from bee samples

  • Amplify the COI-COII intergenic region using established primers (e.g., E2-F and H2-R)

  • Perform restriction fragment length polymorphism (RFLP) analysis with DraI enzyme

  • Compare fragment patterns to reference databases for lineage and haplotype assignment

How are the major evolutionary lineages of honey bees identified through mtDNA analysis?

Honey bee subspecies are classified into five major evolutionary lineages (A, M, C, O, and Y) based on mitochondrial DNA markers. The three main lineages found in European honey bee populations are:

LineageGeographic OriginCommon SubspeciesKey Characteristics
AAfricaA. m. scutellata, A. m. adansoniiAfrican lineage, characterized by specific P and Q elements in COI-COII region
MWestern MediterraneanA. m. mellifera, A. m. iberiensisWest Mediterranean lineage, specific P element structure
CNorth MediterraneanA. m. ligustica, A. m. carnicaNorth Mediterranean lineage, absence of P element

These lineages can be identified using:

  • The DraI RFLP test of the COI-COII intergenic region

  • Sequence analysis of the NADH dehydrogenase 2 (ND2) gene

  • DNA metabarcoding of a 406 bp fragment of the COI gene containing diagnostic SNPs

Recent studies using these approaches have shown that honey bee populations in the USA heavily rely on C-lineage bees (93.79%), with 76.64% belonging to just two haplotypes: C1 (38.76%) characterizing A. m. ligustica and C2j (37.62%) characterizing A. m. carnica .

What is the structure and function of cytochrome c oxidase subunit II in honey bees?

COII (MT-CO2) is a critical subunit of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial respiratory chain that catalyzes electron transfer from reduced cytochrome c to oxygen. In honey bees, as in other eukaryotes, this protein is encoded by mitochondrial DNA.

The COII protein contains:

  • A transmembrane domain with alpha-helices anchoring it to the inner mitochondrial membrane

  • A periplasmic domain that interacts with cytochrome c

  • A binuclear copper center (CuA) located in a conserved cysteine loop, critical for electron transfer

In A. mellifera ligustica, the COII gene has been fully sequenced . The region exhibits more A+T richness compared to Drosophila, and parsimony analyses using mouse and Xenopus sequences as outgroups have shown significantly more amino acid substitutions on the branch to Apis (120) than on that to Drosophila (44), indicating different long-term evolutionary rates of hymenopteran and dipteran mtDNA .

How can the COI metabarcoding approach be implemented for differentiating honey bee lineages and authenticating honey origin?

COI metabarcoding offers a highly sensitive method for identifying the entomological origin of honey, particularly for products with protected designation of origin (PDO) labels. Recent research has developed an advanced approach targeting a 406 bp fragment of the COI gene containing 11 single nucleotide polymorphisms (SNPs) with fixation index (FST) = 1, indicating complete differentiation between populations .

Implementation protocol:

  • Target region selection: The region between positions 1848 bp and 2253 bp in the COI gene was identified as most informative through FST analysis of sliding windows across complete mitogenomes.

  • Two-step indexing approach:

    • First PCR: Amplify target region using modified primers containing overhang adapters

    • Second PCR: Add unique indexes for sample identification

  • Sequencing: Pool samples and sequence on Illumina MiSeq platform using 2 × 250 cycles v2 nano chemistry

  • Bioinformatic analysis:

    • Quality filtering of raw sequences

    • Alignment to reference database containing sequences from different lineages

    • Lineage assignment based on diagnostic SNPs

This method has successfully differentiated honey samples produced by bees from different maternal lineages, including mixtures that could not be resolved by previous PCR-HRM methods. For example, it detected both A- and M-lineages in samples from the Iberian Peninsula and C-lineage predominance in northwestern European commercial honeys .

What are the patterns of Apis mellifera ligustica introgression in protected populations of the native dark honey bee (A. m. mellifera)?

The introduction of non-native honey bee subspecies, particularly A. m. ligustica, has significant implications for the genetic integrity of native A. m. mellifera populations. Research using both mitochondrial and nuclear markers has revealed complex patterns of introgression:

PopulationmtDNA (% C-lineage)Nuclear DNA (Mean admixture coefficient)Haplotype Diversity
Læsø (Denmark)9.5%0.420.220 ± 0.080
Colonsay (UK)0%0.080.000 ± 0.000
Flekkefjord (Norway)0%0.150.074 ± 0.050
Ireland0%0.110.106 ± 0.055
East Midlands (UK)0%0.270.245 ± 0.085

Analysis of microsatellite loci and mtDNA markers (DraI RFLP of COI-COII region) has shown differential introgression patterns: nuclear DNA shows more widespread admixture while mtDNA introgression is more limited in protected populations . This asymmetry likely stems from the social nature of honey bees, where both genome compartments are differentially affected by individual and colonial reproduction levels.

Implications for conservation:

  • Protected island populations (e.g., Colonsay) show higher levels of genetic purity

  • Continental populations exhibit variable degrees of introgression

  • Selection methods should consider both nuclear and mitochondrial markers

  • Conservation strategies should focus on maintaining native genetic diversity while managing introgression

How do different molecular markers compare in resolving honey bee subspecies and detecting hybridization?

Various molecular markers provide different levels of resolution for identifying honey bee subspecies and detecting hybridization:

Marker TypeTarget RegionResolution CapacityAdvantagesLimitations
DraI RFLPCOI-COII intergenicLineage and major haplotypesSimple, established methodologyLimited resolution within lineages
DNA sequencingCOI-COII, ND2High within-lineage resolutionProvides complete sequence informationMore costly, time-consuming
MicrosatellitesNuclear genomePopulation structure, hybridizationDetects nuclear introgressionRequires multiple loci
SNP analysisCOI (406 bp fragment)Lineage differentiationHigh sensitivity for mixturesRequires advanced sequencing
MetabarcodingCOIMixture analysisCan detect multiple lineages in one sampleRequires bioinformatic expertise

Research has shown that combining markers provides the most comprehensive assessment. For example, in a study of European honey bee populations, microsatellite analysis revealed nuclear introgression of A. m. ligustica genes into A. m. mellifera populations, while mtDNA analysis showed less introgression of C-lineage mitotypes .

For the most accurate subspecies identification in hybrid zones, researchers should employ:

  • Mitochondrial markers to determine maternal lineage

  • Multiple nuclear markers to assess hybridization levels

  • Morphometric analysis as a complementary approach

What are the optimal expression systems and purification strategies for producing recombinant COII protein?

While the search results don't specifically address expression systems for COII from A. m. ligustica, general approaches for producing recombinant mitochondrial proteins can be applied, with necessary modifications for this specific target:

Expression systems comparison:

SystemAdvantagesDisadvantagesRecommended Applications
E. coliHigh yield, low cost, rapidLacks post-translational modifications, often forms inclusion bodiesStructure studies, antibody production
Insect cellsMore natural folding, post-translational modificationsModerate cost, longer production timeFunctional studies, enzymatic assays
Honey bee cell linesNative environment, correct post-translational processingLimited availability, technical challengesInteraction studies with other honey bee proteins

For COII specifically, insect cell expression systems may offer the best compromise between yield and proper protein folding. The AmE-711 cell line derived from honey bee embryos could potentially provide an optimal expression environment for A. m. ligustica COII, though establishing this system requires specialized expertise.

Purification strategy:

  • Add appropriate affinity tag (His6 is commonly used)

  • Express in selected system with optimized conditions

  • Solubilize membrane proteins using appropriate detergents

  • Purify using affinity chromatography

  • Remove tag if necessary

  • Confirm purity using SDS-PAGE and western blot

  • Verify activity using appropriate functional assays

This approach has been successful for other mitochondrial proteins as shown by the commercially available cytochrome c oxidase subunit Va , which could serve as a model for COII production.

What PCR conditions and primers are optimal for amplifying the COI-COII region in Apis mellifera ligustica?

For successful amplification of the COI-COII region in A. m. ligustica, researchers have established several effective protocols:

Standard DraI RFLP test primers:

  • E2-F: 5′-GGCAGAATAAGTGCATTG-3′

  • H2-R: 5′-CAATATCATTGATGACC-3′

PCR reaction mixture:

  • 12.5 μL of 2X Master Mix for PCR

  • 1 μL of each primer (10 μM)

  • 9.5 μL nuclease-free water

  • 2 μL of DNA template

Thermal cycling conditions:

  • Initial denaturation: 92°C for 3 min

  • 35 cycles of:

    • Denaturation: 92°C for 30 sec

    • Annealing: 47°C for 90 sec

    • Extension: 63°C for 2 min

  • Final extension: 63°C for 10 min

  • Hold at 4°C

For metabarcoding approaches targeting the highly informative 406 bp COI fragment, researchers can use the modified primers with overhang adapters as described in recent studies .

The quality of DNA extraction is critical - methods suitable for degraded DNA should be employed when working with honey samples rather than bee tissue.

How can researchers interpret and resolve discrepancies in COII sequence data across different studies?

Discrepancies in COII sequence data across different studies are common and can arise from several sources:

  • Technical variations: Different PCR conditions, sequencing platforms, and primer sets can introduce variability

  • Population sampling: Geographic variations in subspecies distribution may not be adequately represented

  • Nomenclature inconsistencies: Different naming conventions for haplotypes complicate comparisons

  • Hybrid populations: Varying degrees of introgression can lead to mixed sequence profiles

Resolution approach:

To address these challenges, researchers should:

  • Standardize methodologies:

    • Use established primer sets with known performance

    • Follow published protocols with minimal modifications

    • Document any methodological changes thoroughly

  • Implement in silico analysis:

    • Apply the in silico DraI test as proposed by Madella et al. (2021) to reconcile haplotype naming discrepancies

    • Use standardized bioinformatic pipelines for sequence analysis

  • Compare with reference sequences:

    • Use high-quality reference sequences from well-characterized populations

    • Include sequences from multiple geographic origins for context

  • Consider population history:

    • Account for known introgression events

    • Recognize that some discrepancies reflect biological reality rather than methodological issues

For example, studies of Italian honey bee populations revealed a hybrid origin with both C and M lineages, which had been previously obscured because samples often came from areas where the M mitochondrial lineage was absent . This finding represented a biological reality rather than a methodological error, changing our understanding of European honey bee evolutionary history.

What quality control measures should be implemented when studying COII in hybrid honey bee populations?

When studying COII in hybrid honey bee populations, robust quality control measures are essential to ensure accurate data interpretation:

Sampling strategy:

  • Include reference samples from pure subspecies populations

  • Collect adequate sample sizes (30-50 colonies per population is recommended)

  • Document geographic origins precisely

  • Sample across multiple apiaries to capture regional variation

Laboratory controls:

  • Include positive controls from known lineages in each PCR batch

  • Use negative controls to detect contamination

  • Implement technical replicates (at least triplicates for critical samples)

  • Sequence PCR products in both directions to verify mutations

Data validation:

  • Cross-validate with complementary markers (e.g., ND2 gene, microsatellites)

  • Apply multiple analytical methods (e.g., RFLP and direct sequencing)

  • Calculate fixation indices (FST) to quantify population differentiation

  • Use statistical approaches like AMOVA (Analysis of Molecular Variance) to partition genetic variation

Bioinformatic quality control:

  • Set stringent quality thresholds for sequence reads

  • Align sequences to multiple reference genomes

  • Check for unexpected insertions/deletions that might indicate sequencing errors

  • Verify SNPs with population-level data

How can the heat shock response be utilized in experimental studies involving recombinant COII expression?

The heat shock response represents an important consideration when working with recombinant COII expression, particularly in honey bee-derived systems. Recent research has demonstrated that heat shock affects virus levels and gene expression in honey bees, with implications for experimental design .

Experimental considerations:

  • Temperature optimization:

    • Standard heat shock conditions (42°C for 4h) induce stress response in honey bees

    • Expression systems may require modified conditions based on cell type

  • Heat shock protein interactions:

    • Six heat shock protein genes show differential expression during heat shock

    • These proteins may affect folding and stability of recombinant COII

    • Consider co-expression of chaperones to improve solubility

  • Monitoring stress markers:

    • Track expression of heat shock genes as quality control

    • Monitor potential aggregation of recombinant proteins

  • Experimental design:

    • Include appropriate temperature controls

    • Consider time-course experiments to determine optimal expression windows

    • Document temperature conditions precisely

When expressing recombinant COII in cellular systems, researchers should be aware that heat shock modulates multiple cellular pathways. In honey bees, heat-shocked individuals showed significant transcriptional changes, including altered expression of immune genes like dicer-like and ago2 . These changes could potentially affect recombinant protein expression efficiency and should be considered when optimizing production protocols.

How can recombinant COII be used to develop improved antibodies for honey bee research?

Recombinant COII can serve as a valuable antigen for developing specific antibodies for honey bee research applications. While commercial antibodies exist for cytochrome c oxidase subunits , subspecies-specific antibodies targeting A. m. ligustica COII would enable more precise investigations:

Development strategy:

  • Express and purify recombinant A. m. ligustica COII with high purity (>95%)

  • Verify protein conformation using circular dichroism or other structural techniques

  • Immunize host animals (typically rabbits) following standard protocols

  • Collect and purify antibodies

  • Validate specificity against both recombinant protein and native honey bee samples

  • Test cross-reactivity with COII from other subspecies

Potential applications:

  • Tissue-specific expression studies of COII

  • Comparative analysis of COII levels across subspecies

  • Investigation of COII protein modifications

  • Immunoprecipitation studies to identify interaction partners

  • Immunohistochemical localization in honey bee tissues

Researchers should validate antibodies using multiple techniques including western blot, immunoprecipitation, and immunohistochemistry to ensure reliability across applications. The database of commercially available antibodies shows multiple sources for cytochrome c oxidase antibodies with different applications , which can serve as reference points for developing subspecies-specific reagents.

What are the most promising applications of COII sequence data for honey bee conservation?

COII sequence data provides valuable insights for honey bee conservation, particularly for subspecies facing genetic introgression:

Conservation applications:

  • Monitoring genetic integrity:

    • Track introgression of non-native mitotypes in protected areas

    • Establish baseline genetic profiles for conservation populations

    • Detect early signs of genetic erosion

  • Identifying conservation priorities:

    • Map remaining pure populations of native subspecies

    • Quantify genetic diversity within and between populations

    • Identify unique haplotypes requiring special protection

  • Designing breeding programs:

    • Select breeding stock based on maternal lineage

    • Implement marker-assisted selection to maintain genetic purity

    • Monitor outcomes of conservation breeding

  • Establishing protected areas:

    • Use COII data to identify regions with high native genetic integrity

    • Design buffer zones around protected populations

    • Monitor effectiveness of geographic isolation

Recent studies demonstrate the concerning decline of native M-lineage honey bees (A. m. mellifera) in northwestern Europe, with commercial honeys from these regions showing predominance of C-lineage bees . Conservation efforts should focus on protecting remaining M-lineage populations and implementing breeding programs to maintain this genetic diversity shaped by thousands of years of natural selection.

By systematically applying COII and other genetic markers, conservation programs can develop evidence-based strategies to preserve honey bee biodiversity while managing the reality of widespread hybridization in managed populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.