Recombinant Apium graveolens Chlorophyll a-b binding protein, chloroplastic (LHC0)

Shipped with Ice Packs
In Stock

Description

Function and Significance

LHC proteins, including Chlorophyll a-b binding proteins, play a crucial role in photosynthesis by :

  • Capturing light energy: They absorb light energy through chlorophyll and carotenoid molecules .

  • Energy transfer: They efficiently transfer the captured light energy to the photosynthetic reaction centers .

  • Pigment stabilization: LHCs stabilize and tune the spectroscopic characteristics of individual pigments and the entire pigment array .

  • Photoprotection: They protect the photosynthetic apparatus when the absorbed light energy exceeds its capacity .

Involvement in Stress Response

LHC-like proteins are often induced under various stress conditions, such as high light, high salinity, elevated temperature, and nutrient limitation . These proteins play key roles in photoprotection, particularly in non-photochemical quenching of absorbed light energy . Some are also involved in regulating chlorophyll synthesis and the assembly and repair of Photosystem II, possibly by mediating the insertion of newly synthesized pigments into the photosynthetic reaction centers .

LHCB Proteins and Abscisic Acid (ABA)

Light-harvesting chlorophyll a/b-binding (LHCB) proteins are apoproteins of the light-harvesting complex of photosystem II . Studies have shown that downregulation of LHCB genes can result in abscisic acid (ABA)-insensitive phenotypes during seed germination and post-germination growth, indicating their positive involvement in developmental processes in response to ABA . ABA is required for the full expression of different LHCB members, and high levels of ABA enhance LHCB expression .

Chlorophyll b's Role

Chlorophyll b (Chl b) plays a significant role in the assembly and accumulation of light-harvesting complexes . It enhances the import of chlorophyll a/b-binding apoproteins into the chloroplast and the assembly of light-harvesting complexes . Mutants lacking Chl b show reduced accumulation of specific LHCPs (light-harvesting chlorophyll a/b-binding proteins), such as Lhcb1, Lhcb6, and Lhca4 .

Diversity and Evolution

The LHC protein family includes LHC-like proteins with varying numbers of transmembrane domains, from one to four . These proteins are found in both eukaryotic photosynthetic organisms and cyanobacteria, suggesting they evolved through gene duplications, deletions, and fusions . Some LHC-like proteins have diverged and acquired new functions over time .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LHC0; Chlorophyll a-b binding protein, chloroplastic; allergen Api g 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-264
Protein Length
Full Length of Mature Protein
Species
Apium graveolens (Celery)
Target Names
LHC0
Target Protein Sequence
RKTVKAPVSDSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRE LEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQS ILSIWATQVILMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLAEDPERSAELKVKELKN GRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Apium graveolens chlorophyll a-b binding protein and what is its biological function?

Apium graveolens chlorophyll a-b binding protein (CAB), also known as Api g 3 in allergen nomenclature, is a ~24.8 kDa protein (pI 4.87) that forms an integral component of the light-harvesting complex in chloroplasts. This protein plays a crucial role in photosynthesis by binding chlorophyll molecules and facilitating light energy capture and transfer to photosynthetic reaction centers .

The protein exhibits high sequence homology (80-90% amino acid identity) with chlorophyll a-b binding proteins from various plant species including white mustard, tomato, soybean, spinach, potato, and cereals. This conservation reflects its fundamental importance in photosynthetic function across plant species .

What methods are most reliable for studying chlorophyll a-b binding protein interactions with other photosystem components?

Several complementary techniques provide robust analysis of protein-protein interactions:

  • Co-immunoprecipitation (Co-IP):

    • Useful for confirming direct physical interactions

    • Example protocol: "A modified immunoprecipitation (IP) was performed, incubating protein extract with biotinylated target protein and streptavidin beads. The eluant was run on a gel and whole lanes were sent for mass spectrometric analysis."

  • Yeast two-hybrid (Y2H) screening:

    • For identifying novel interaction partners

    • The LHC coding sequence is fused to a DNA-binding domain and screened against a library of prey proteins

  • Bimolecular fluorescence complementation (BiFC):

    • For visualizing interactions in planta

    • Split fluorescent protein halves are fused to potential interacting proteins

  • Surface plasmon resonance (SPR):

    • For quantitative binding kinetics analysis

    • Provides association and dissociation rate constants

  • Cross-linking coupled with mass spectrometry:

    • For mapping protein interaction interfaces

    • Example: "Eighteen IgE reactive spots from celeriac extract were obtained in 2D gel electrophoresis. Mass analysis identified them as members of various protein families."

How does Apium graveolens chlorophyll a-b binding protein respond to various stress conditions?

Research indicates that chlorophyll a-b binding proteins play significant roles in stress responses:

  • Heat stress response:

    • CAB gene expression is regulated by heat shock factors (HSFs)

    • "AgHSF family members perform a key role in response to high temperature, and AgHSFa6-1 acts as a positive regulator."

    • Heat stress experiments often involve exposing plants to elevated temperatures (38-42°C) and monitoring gene expression changes

  • Oxidative stress:

    • CAB proteins may participate in ROS scavenging mechanisms

    • Studies show that "AGWE can reduce reactive oxygen species and thiobarbituric acid reactive substances in cells induced by LPS."

  • Light stress adaptation:

    • CAB proteins help redistribute excitation energy under high light conditions

    • "Stomata are the main channels for gas exchange, and plants normally adjust the stomatal conductance to vary their temperature."

  • Experimental approaches:

    • Gene expression analysis: "RT-qPCR was performed using SYBR Premix Ex Taq. All the steps followed the manufacturer's instruction (CFx384TM Real-Time System), and the expression level was calculated by the 2-△△Ct method."

    • Physiological measurements: "The free proline content was measured according to the acidic-ninhydrin-based colorimetric method. The activities of superoxide dismutase (SOD) and peroxidase (POD) were measured using the nitrogen blue tetrazolium (NBT) and the guaiacol methods, respectively."

How can researchers effectively use virus-induced gene silencing (VIGS) to study chlorophyll a-b binding protein function in Apium graveolens?

VIGS offers a powerful approach for functional genomics studies of CAB proteins:

  • Vector selection and construction:

    • Tobacco rattle virus (TRV) vectors have shown efficacy in various plant species

    • "TRV and the phytoene desaturase gene KoPDS were used as the vector and target gene, respectively, to establish a virus-induced gene silencing system (VIGS)."

  • Target sequence selection:

    • Design gene-specific fragments (300-500 bp) with minimal off-target potential

    • Verify specificity using BLAST against the celery genome

  • Transformation method:

    • Agrobacterium-mediated infiltration is commonly used

    • "RNA-Seq and qRT-PCR showed that the highest gene-silencing efficiency could reach 90% after 10 days of inoculation and maintain above 80% after 15 days."

  • Phenotypic analysis:

    • Monitor changes in photosynthetic efficiency using PAM fluorometry

    • Measure chlorophyll content and composition

    • Analyze light-harvesting capacity and energy transfer efficiency

  • Validation metrics:

    • qRT-PCR to confirm gene silencing efficiency

    • Western blot to verify protein reduction

What is the current understanding of the role of Apium graveolens chlorophyll a-b binding protein in immune modulation?

Recent research has revealed unexpected immunomodulatory functions of chlorophyll a-b binding proteins:

  • TGFβ1 binding capability:

    • "Chlorophyll a-b binding protein AB96 was able to bind to, and functionally inhibit, active TGFβ1"

    • This represents "the first plant-derived cytokine-neutralizing protein to be described"

  • Experimental verification methods:

    • Binding assays: "Using E.coli derived recombinant full-length folded CabBP AB96, binding assays found that CabBP AB96 was able to bind active TGFβ1"

    • Functional assays: "CabBP AB96 was also able to inhibit the function of TGFβ1 in a significant manner when compared to either STI or CabBP buffer"

  • Allergenic properties:

    • "Api g 3 (proposed name for Chlorophyll a/b Binding Protein) is probably a minor allergen (IgE-binding in <50% of patients)"

    • "Immunoblots showed distinct IgE reactive bands at 10 and 16 kDa while broad reactivity was observed in the range between 25 and 100 kDa."

  • Potential applications:

    • Development of novel immunomodulatory agents

    • Understanding plant-derived bioactive compounds

How does Apium graveolens chlorophyll a-b binding protein compare structurally and functionally to homologs in other species?

Comparative analysis reveals important evolutionary and functional insights:

SpeciesHomology to Celery CABKey Structural DifferencesFunctional Specialization
White mustard80-90%Minimal N-terminal variationsSimilar light-harvesting function
Tomato80-90%Similar core structureThermal stability adaptations
Spinach80-90%Conserved chlorophyll-binding domainsCold tolerance adaptations
Garden pea80-90%Variable loop regionsSimilar photosynthetic efficiency
Cucumber80-90%Minor variations in transmembrane domainsComparable light absorption spectrum
Barley80-90%Divergent N-terminal transit peptideEnhanced thermal stability

"Sequence Homology shows 80-90% amino acid sequence identities to chlorophyll a/b binding proteins from white mustard, tomato, soybean, spinach, potato, barley, cucumber, garden pea, maize, rice, and wheat."

The high conservation reflects the fundamental importance of photosynthetic function, while subtle variations likely represent adaptations to specific environmental conditions.

What genetic modification approaches have been successful for enhancing or altering chlorophyll a-b binding protein expression or function?

Several genetic approaches have proven effective for modifying CAB expression and function:

  • Overexpression strategies:

    • "For the overexpression of AgHSFa6-1, the double-cauliflower mosaic virus 35S (CaMV 35S) promoter and NOS terminator from pSAT1-cEYFP-N1 were amplified and subcloned into the vector pCAMBIA1301."

    • Similar approaches can be used for CAB overexpression

  • CRISPR/Cas9 genome editing:

    • For precise modification of CAB gene sequences

    • Single or multiple guide RNAs can target specific domains

  • Promoter swapping:

    • Replacing native promoters with inducible or tissue-specific alternatives

    • "The expression vector 35S:Protein:GFP was constructed with two BamH I restriction enzyme sites."

  • Domain swapping experiments:

    • Creating chimeric proteins with domains from different species

    • Useful for understanding functional specialization

  • RNA interference:

    • "VIGS was used to verify the role of a Chlorophyll a/b binding protein (Cab) gene in leaf carbon sequestration."

    • Allows for tissue-specific and temporal control of gene silencing

How is mitochondrial-chloroplast crosstalk mediated by chlorophyll a-b binding proteins?

Emerging research suggests important roles for CAB proteins in organellar communication:

  • Dual-targeted proteins:

    • Some CAB-like proteins may localize to both chloroplasts and mitochondria

    • "Sequence similarity between the mitochondrial and chloroplast genomes in A. graveolens" has been observed

  • Retrograde signaling:

    • CAB proteins may participate in retrograde signaling pathways

    • "Homologous sequence results were visualized using Circos. The chloroplast genomes of A. graveolens and A. leptophyllum were downloaded from NCBI with accession numbers MZ328720 and MZ328721, respectively."

  • Stress response coordination:

    • Evidence suggests coordinated responses between organelles during stress

    • "Mitochondrial function was measured by cellular ATP analysis. Cellular ATP levels were then measured in both cells exposed to treatment and H2O2 using a fluorometric assay kit."

  • Research techniques:

    • Multi-organelle isolation and proteomics

    • Fluorescence co-localization studies

    • Metabolic flux analysis

What novel applications of recombinant Apium graveolens chlorophyll a-b binding protein are being explored in metabolic engineering?

Innovative applications are emerging in several areas:

  • Photosynthetic efficiency enhancement:

    • Modifying CAB proteins to optimize light harvesting under variable conditions

    • "AgHSF family members perform a key role in response to high temperature, and AgHSFa6-1 acts as a positive regulator by augmenting the ROS-scavenging system to maintain membrane integrity, reducing stomatal apertures to control water loss."

  • Metabolic pathway engineering:

    • Using CAB proteins to enhance production of high-value metabolites

    • "Apium graveolens water extract (AGWE) can reduce reactive oxygen species and thiobarbituric acid reactive substances."

  • Biopharmaceutical applications:

    • Based on the discovery that "chlorophyll a-b binding protein AB96 was able to bind to, and functionally inhibit, active TGFβ1."

    • This represents the "first plant-derived cytokine-neutralizing protein to be described."

  • Stress tolerance improvement:

    • "Mitochondrial genome analysis provides insights into evolution and phylogeny relationships."

    • CAB protein engineering could enhance plant adaptation to changing environmental conditions

  • Experimental verification approaches:

    • Metabolomics analysis: "This study explored the differences in the types and contents of metabolites in celery cultivars with different-colored petioles."

    • Transgenic testing: "The transgenic T0 lines were selected using hygromycin on MS medium, and the hygromycin-resistant plants were selected out to obtain T1 seeds for PCR assays."

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.