Recombinant Aplysia californica 5-hydroxytryptamine receptor 1 (5HTB1)

Shipped with Ice Packs
In Stock

Description

Table 1: Key Molecular Properties

PropertyDetail
Gene Name5HTB1
Expression RegionResidues 1–453
Receptor ClassG-protein-coupled (Gi/Go)
Binding AffinityHigh affinity for LSD (KdK_d in nanomolar range)
Storage ConditionsTris-based buffer with 50% glycerol; store at -20°C or -80°C

Functional Properties

The 5HTB1 receptor is negatively coupled to adenylate cyclase, leading to inhibition of cAMP production upon activation . Key functional insights include:

  • Pharmacological Profile:

    • Agonists: 5-carboxamidotryptamine (5-CT), 8-OH-DPAT .

    • Antagonists: Methiothepin .

    • Binds LSD with higher affinity (Kd=2.6K_d = 2.6 nM) than serotonin (Kd=6.9K_d = 6.9 nM) .

  • Tissue Distribution:

    • Ubiquitously expressed in Aplysia tissues, including central and peripheral nervous systems .

    • Localized in neuronal cell bodies and nerve terminals, but mRNA is absent in nerve sheaths .

ELISA and Protein Studies

Recombinant 5HTB1 is commercially available for immunoassays (e.g., ELISA kits) . These tools enable:

  • Quantification of receptor expression in Aplysia tissues.

  • Analysis of ligand-binding kinetics and G-protein coupling mechanisms .

Mechanistic Insights

  • Signal Transduction: 5HTB1 activation inhibits forskolin-stimulated cAMP accumulation, confirming its coupling to Gi proteins .

  • Evolutionary Conservation: Functional homology with mammalian 5-HT1 receptors underscores its utility in studying conserved serotonin signaling pathways .

Key Research Findings

  • Diverse Roles in Behavior: 5HTB1 modulates synaptic plasticity underlying learning and memory in Aplysia, including long-term facilitation .

  • Cross-Species Relevance: Structural and functional parallels with human 5-HT1B receptors (e.g., vasoconstriction, neurotransmitter release inhibition) .

  • MAP Kinase Activation: Potential involvement in MAP kinase pathways, suggesting roles beyond cAMP modulation .

Comparative Analysis with Vertebrate Receptors

FeatureAplysia 5HTB1Human 5-HT1B
CouplingGi/GoGi
ExpressionNeurons, peripheral tissuesCNS, blood vessels (meninges)
Ligand SpecificityBinds LSD > 5-HTBinds ergotamine, triptans
Physiological RoleSynaptic plasticity, locomotionMigraine relief, mood regulation

Future Directions

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve active-state conformations .

  • Behavioral Models: Knockout studies to elucidate 5HTB1’s role in Aplysia learning circuits .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will accommodate your needs accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
5HTB1; 5-hydroxytryptamine receptor 1; 5-HTB1; Serotonin receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-453
Protein Length
full length protein
Species
Aplysia californica (California sea hare)
Target Names
5HTB1
Target Protein Sequence
MKSLKSSTHDVPHPEHVVWAPPAYDEQHHLFFSHGTVLIGIVGSLIITVAVVGNVLVCLA IFTEPILSHSKSNFFIVSLAVADLLLALLVMTFALVNDMYGYWLFGETFCFIWMSADVMC ETASIFSICVISYDRLKQVQKPLHYEEFMTTTRALLIIACLWICSFVLSFVPIFLEWHEL SVEEIKAIFKDNKTEKEKALEAHNFSSALNQTLGDNQKSNAKHVCLFDVHFTYSVIYSFI CFYVPCTLMLTNYLRLFLIAQTHQVRIRSLQMTNPPQLRGQGASSYRNQGTQGSKAARTL TIITGTFLACWLPFFIINPIAAADEHLIPLECFMVTIWLGYFNSSVNPIIYGTSNSKFRA AFKRLLRCRSVKSVVGSISPVSPAYRAFSWIRPSRLDLSSSEHPSDACDTGRGKNSKGGD CATADPTKPDVSVSEEIIYAGTKVFDSDTAFSS
Uniprot No.

Target Background

Function
This is one of several receptors for 5-hydroxytryptamine (serotonin). 5-HT plays crucial roles in various behavioral and physiological processes in aplysia, including feeding, locomotion, circadian rhythm, learning and memory, synaptic plasticity, and synaptic growth. This receptor is mediated by G proteins that stimulate phospholipase C.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Reproductive system.

Q&A

What is the Aplysia californica 5-hydroxytryptamine receptor 1 and how is it related to mammalian serotonin receptors?

The Aplysia californica 5-hydroxytryptamine receptor 1 (5-HT ap1) is a G-protein-coupled receptor that shares significant structural homology with the vertebrate 5-HT 1 receptor subfamily. The receptor consists of 492 amino acids with seven transmembrane domains characteristic of G-protein-coupled receptors. Sequence analysis reveals that 5-HT ap1 shares 51.8% amino acid identity with human 5-HT 1A receptors and 49.6% with human 5-HT 1D receptors within the transmembrane domains and adjacent regions. This receptor belongs to a family of invertebrate 5-HT receptors that likely predates the divergence of the 5-HT receptor subtypes in vertebrates, exhibiting characteristics of both 5-HT 1 and 5-HT 7 receptor subtypes .

How is serotonin involved in Aplysia californica physiology and behavior?

Serotonin (5-HT) plays crucial roles in regulating various behaviors in Aplysia californica, including:

  • Reproduction

  • Feeding

  • Locomotion

  • Circadian rhythm

  • Synaptic plasticity

  • Synaptic growth

These diverse functions are mediated by different receptor subtypes coupled to distinct second-messenger systems. Specifically, serotonin facilitates connections between sensory and motor neurons during behavioral sensitization, which partially mediates the siphon-withdrawal reflex. Additionally, 5-HT levels in Aplysia change significantly with age, increasing rapidly from 4 to 6 months post-hatch, then more slowly from 6 to 13 months .

What are the expression patterns of 5-HT ap1 receptors in Aplysia tissues?

The 5-HT ap1 receptor protein is widely distributed throughout Aplysia tissues, although expression levels vary:

  • Found in every ganglia of the nervous system

  • Present in both the neural sheath and neurons

  • Detected in all peripheral tissues examined, though weakly expressed in some samples

  • 5-HT ap1 mRNA is absent from the sheath, indicating that the protein observed there is likely located on nerve terminals

This widespread distribution suggests that the receptor may play various physiological roles related to inhibition of adenylate cyclase, activation of MAP kinase, and/or modulation of other signaling pathways .

What methodologies are recommended for cloning and expressing functional Aplysia 5-HT receptors in cell lines?

For successful cloning and functional expression of Aplysia 5-HT receptors, the following methodology has been validated:

  • PCR Amplification Strategy:

    • Use degenerate oligonucleotide primers targeting conserved transmembrane domains (particularly domains six and seven)

    • Amplify a fragment (typically 163 bp) that shares sequence identity with 5-HT receptors

  • cDNA Library Screening:

    • Employ PCR-based screening of a kidney cDNA library

    • Use nested oligonucleotides derived from the cDNA and paired primers from vector sequences to amplify the 5' end

  • Expression Vector Construction:

    • PCR-amplify the coding region with primers containing appropriate restriction sites

    • Subclone into expression vectors (e.g., pBact-myc vector) in frame with epitope tags

    • Transfer to mammalian expression vectors (e.g., pCDNA3/RSV)

  • Cell Line Establishment:

    • Introduce recombinant plasmid into HEK 293 cells via calcium phosphate-mediated transfection

    • Select transfected cells with Geneticin

    • Amplify isolated foci

    • Confirm expression using immunofluorescence with appropriate antibodies

    • Select cell lines with highest receptor expression for functional assays

How can researchers pharmacologically characterize 5-HT receptors in Aplysia, and what compounds are effective antagonists?

Pharmacological characterization of Aplysia 5-HT receptors requires:

  • Radioligand Binding Assays:

    • Use serotonergic radioligands such as [N-methyl-³H]lysergic acid diethylamide

    • Determine binding affinities (Kd values) for various ligands

    • Perform competition assays with 5-HT agonists and antagonists

  • Functional Coupling Assays:

    • Measure forskolin-stimulated cAMP accumulation to assess adenylyl cyclase coupling

    • Determine dose-dependent effects of 5-HT and its agonists

  • Effective Antagonists:
    For adenylyl cyclase-coupled 5-HT receptors (5-HT apAC) in Aplysia CNS, the following antagonists have proven effective with this rank order of potency:

    AntagonistRelative PotencyKb Value
    MethiothepinHighest18 nM
    MetergolineHigh-
    FluphenazineHigh-
    ClozapineModerate-
    CyproheptadineModerate-
    RisperidoneModerate-
    RitanserinModerate-
    NAN-190Low-

    Notably, methiothepin completely blocks 5-HT stimulation of adenylyl cyclase in Aplysia CNS membranes .

What experimental approaches are recommended for investigating the coupling of Aplysia 5-HT receptors to second messenger systems?

To investigate 5-HT receptor coupling to second messenger systems in Aplysia:

  • Adenylate Cyclase Coupling:

    • Measure cAMP accumulation in stable cell lines expressing the receptor

    • Apply 5-HT or its agonists (e.g., 5-carboxamidotryptamine maleate, 8-OH-DPAT)

    • Quantify dose-dependent inhibition of forskolin-stimulated cAMP accumulation

    • Use specific inhibitors to verify signaling pathways (e.g., GDP-β-S to block G-protein signaling)

  • G-protein Involvement:

    • Inject non-hydrolysable GDP analogues (e.g., GDP-β-S, 10 mM) via micropipette

    • Assess blockade of 5-HT effects

    • Consider that Aplysia G-proteins (Gsα, Goα, Giα, and Gβ) are functionally similar to mammalian counterparts

  • Electrophysiological Recording:

    • Record glutamate-evoked postsynaptic potentials (Glu-PSPs) from isolated neurons

    • Apply 5-HT via perfusion and measure changes in response amplitude

    • Investigate persistence of effects after washout

  • Combined Approaches:

    • Correlate biochemical findings with electrophysiological effects

    • Consider both presynaptic and postsynaptic mechanisms

    • Verify using specific antagonists identified in pharmacological profiling

How does the developmental stage and age of Aplysia affect 5-HT levels and receptor function in experimental designs?

When designing experiments involving Aplysia 5-HT systems, researchers must account for age-dependent variations:

  • Developmental Changes in 5-HT Levels:

    • Serotonin increases rapidly from 4 to 6 months post-hatch

    • Slower increase from 6 to 13 months

    • When scaled by soluble ganglion protein, 5-HT increases from 3 to 6-7 months, reaches maximum, then decreases

  • Age vs. Weight Considerations:

    • Animals of same age can have different weights and different 5-HT levels

    • Animals of same weight but different ages have different 5-HT levels

    • Age-dependence is more significant than weight-dependence

    • Statistical analysis shows 5-HT varies significantly with both age and weight

  • Experimental Design Recommendations:

    • Standardize animal age rather than weight when possible

    • Include age as a variable in statistical analyses

    • Consider measuring 5-HT content in experimental tissues

    • For developmental studies, use lab-reared animals with known post-hatch ages

    • When using wild-caught specimens, account for potential age-related variability

What methodological approaches can resolve conflicting data between in vitro cellular studies and in vivo behavioral effects of 5-HT in Aplysia?

To reconcile potentially conflicting data between cellular and behavioral studies:

  • Isolated Cell Preparations:

    • Use solitary siphon motor neurons in dissociated cell culture

    • Apply focal pulses of putative transmitters (e.g., glutamate)

    • Record responses before and after 5-HT application

    • Control for absence of presynaptic elements

  • Pharmacological Dissection:

    • Apply specific antagonists at different concentrations

    • Note that methiothepin may be less effective in blocking AC-mediated effects in electrophysiological experiments than in blocking AC stimulation in membrane preparations

    • Compare efficacy of multiple antagonists (e.g., cyproheptadine also blocks 5-HT-induced increases in sensory neuron excitability)

  • Consider Multiple Pathway Activation:

    • The same receptor may couple to different pathways in different cell types

    • 5-HT receptors can stimulate or inhibit adenylate cyclase

    • Mammalian 5-HT 1A receptors inhibit adenylate cyclase via Gi but also mediate K+ channel opening via different G-protein subunits

    • Various G-protein-coupled receptors can activate MAP kinase through Gβγ subunits

  • Integrative Approaches:

    • Combine in vitro cellular, biochemical, and electrophysiological studies

    • Correlate with behavioral observations

    • Consider that 5-HT may act through multiple receptor subtypes simultaneously in vivo

How does the crystal structure of 5-HT receptors inform binding site interactions and ligand specificity?

While a crystal structure specifically for Aplysia 5-HT receptors is not currently available, comparative analysis with human 5-HT receptors provides valuable insights:

  • Binding Pocket Structure:

    • Inverse agonists like methiothepin (MT) occupy only the conserved orthosteric binding pocket

    • This explains the wide spectrum effect of MT on various serotonin receptors

    • In contrast, agonists may engage additional binding sites

  • Structural Features Affecting Ligand Binding:

    • The seven transmembrane domains create a ligand-binding pocket

    • Specific amino acid residues within this pocket determine ligand specificity

    • Potential differences in these residues between vertebrate and invertebrate receptors may account for pharmacological differences

  • Structural Implications for Crystallization Studies:

    • Crystallization of G-protein-coupled receptors often requires modification, such as replacing the third intracellular loop with fusion partners

    • Novel optimized variants (e.g., OB1) that enhance intermolecular polar interactions can facilitate crystallization

    • These structural modifications must be considered when interpreting binding data

What are the most reliable methodologies for analyzing pharmacological profiles of Aplysia 5-HT receptors compared to mammalian counterparts?

For comparative pharmacological profiling:

  • Standardized Binding Assays:

    • Determine Kd and Ki values for various ligands

    • The 5-HT ap1 receptor shows high affinity for LSD, 5-CT, methiothepin, and 5-HT

    • These values are comparable to those obtained with vertebrate 5-HT 1 receptors

    LigandAffinity for Aplysia 5-HT ap1Comparison to Vertebrate Receptors
    LSD, 5-CT, methiothepin, 5-HTHigh affinityComparable to all 5-HT 1 subtypes
    8-OH-DPAT, NAN-190Low affinityMore similar to 5-HT 7 than 5-HT 1A
  • Functional Coupling Assessment:

    • Compare adenylate cyclase inhibition or stimulation

    • 5-HT ap1 is negatively coupled to adenylate cyclase

    • Consider G-protein coupling efficiency across species

  • Cross-Species Expression Studies:

    • Express Aplysia receptors in mammalian cells

    • Test coupling to mammalian G-proteins

    • The efficient coupling of invertebrate G-protein-coupled receptors to mammalian G-proteins demonstrates evolutionary conservation of these signaling mechanisms

How can researchers isolate and characterize specific 5-HT receptor subtypes from mixed neural tissues in Aplysia?

To isolate and characterize specific 5-HT receptor subtypes:

  • Molecular Cloning Approaches:

    • Use PCR with degenerate primers targeting conserved regions

    • Screen cDNA libraries from specific tissues (e.g., kidney, neural)

    • Sequence analysis to identify receptor subtypes

  • Immunological Methods:

    • Produce antisera against receptor-specific peptides

    • Use for Western blot analysis to detect receptor protein

    • Apply immunohistochemistry to localize receptors in tissues

    • 5-HT ap1 protein has been detected in all tested tissues using specific antisera

  • mRNA Detection:

    • RT-PCR to detect receptor mRNA in specific tissues

    • Compare mRNA and protein expression patterns

    • The absence of 5-HT ap1 mRNA in the neural sheath despite protein detection indicates the protein may be located on nerve terminals

  • Functional Separation:

    • Pharmacological profiling with subtype-selective ligands

    • Adenylate cyclase assays to distinguish receptors coupled to different second messenger systems

    • Electrophysiological characterization in isolated neurons

What experimental paradigms best utilize Aplysia 5-HT receptors for studying learning and memory mechanisms?

Aplysia provides several powerful experimental paradigms for studying learning and memory mechanisms involving 5-HT receptors:

  • Sensitization of the Siphon-Withdrawal Reflex:

    • 5-HT facilitates connections between sensory and motor neurons

    • This facilitation mediates behavioral sensitization

    • Both presynaptic and postsynaptic mechanisms may contribute

    • Methiothepin and cyproheptadine can block 5-HT effects on sensory neuron firing properties

  • Isolated Neuron Preparations:

    • Study solitary siphon motor neurons in dissociated cell culture

    • Apply focal pulses of glutamate (putative sensory neuron transmitter)

    • Record glutamate-evoked postsynaptic potentials (Glu-PSPs)

    • Perfuse 5-HT to observe facilitation effects

    • This approach isolates postsynaptic 5-HT actions

  • Cellular Mechanisms of Long-Term Facilitation:

    • Investigate 5-HT-induced activation of MAP kinase in sensory neurons

    • This activation is implicated in establishing long-term facilitation

    • Determine whether specific receptor subtypes (e.g., 5-HT ap1) are involved

    • Study the temporal dynamics of facilitation (effects can persist 40+ minutes after 5-HT washout)

How can comparative analyses between Aplysia and human 5-HT receptors inform evolutionary understanding of serotonergic systems?

Comparative analyses reveal important evolutionary insights:

  • Receptor Structure Conservation:

    • Aplysia 5-HT receptors show significant sequence homology with vertebrate receptors

    • 5-HT ap1 exhibits characteristics of both 5-HT 1 and 5-HT 7 receptors

    • This suggests it may be closer to the ancestral receptor that existed before divergence of vertebrate receptor subtypes

  • Functional Conservation:

    • Despite evolutionary distance, invertebrate G-protein-coupled receptors efficiently couple to mammalian G-proteins

    • G-proteins in Aplysia (Gsα, Goα, Giα, and Gβ) are functionally similar to mammalian counterparts

    • This demonstrates remarkable evolutionary conservation of signaling mechanisms

  • Pharmacological Divergence and Conservation:

    • Some ligands (LSD, 5-CT, methiothepin) show similar affinity profiles across species

    • Others (8-OH-DPAT, NAN-190) exhibit significant differences

    • These differences can reveal important structural determinants of ligand binding

What are the recommended controls and validation steps for ensuring reproducibility in Aplysia 5-HT receptor research?

To ensure reproducibility in Aplysia 5-HT receptor research:

  • Age and Weight Standardization:

    • Control for animal age, as serotonin levels vary significantly with development

    • Document both age and weight of specimens

    • Consider that age-dependence is more significant than weight-dependence

  • Receptor Expression Validation:

    • Confirm receptor expression using multiple techniques:

      • RT-PCR for mRNA detection

      • Western blot for protein detection

      • Functional assays to verify activity

    • Consider tissue-specific expression levels

  • Pharmacological Validation:

    • Use multiple antagonists with different chemical structures

    • Include positive and negative controls in binding assays

    • Test dose-response relationships at multiple concentrations

    • Compare results with published pharmacological profiles

  • Functional Assay Controls:

    • Include G-protein coupling controls (e.g., GDP-β-S)

    • For electrophysiological studies, perform time-matched control experiments

    • Account for potential rundown or sensitization in repeated measurements

    • Verify specificity of observed effects using antagonists

How might recent advances in structural biology techniques be applied to better characterize Aplysia 5-HT receptors?

Recent structural biology advances offer promising approaches:

  • Optimized Fusion Proteins for Crystallization:

    • Novel fusion partners like OB1 (optimization variant of BRIL) enhance crystallization

    • These can replace the third intracellular loop (ICL3) of G-protein-coupled receptors

    • Optimization includes strategic amino acid substitutions that enhance intermolecular polar interactions

  • Cryo-Electron Microscopy:

    • Allows structure determination without crystallization

    • May be particularly valuable for membrane proteins like 5-HT receptors

    • Could reveal conformational changes associated with different functional states

  • Molecular Dynamics Simulations:

    • Use structural data to model receptor dynamics

    • Investigate ligand binding mechanisms

    • Predict effects of mutations on receptor function

  • Structure-Based Drug Design:

    • Once structures are available, design specific ligands

    • Develop subtype-selective compounds for experimental use

    • These can help dissect the roles of different 5-HT receptor subtypes in Aplysia physiology and behavior

What are the most common challenges in expressing functional Aplysia 5-HT receptors in heterologous systems and how can they be addressed?

Common challenges and solutions include:

  • Expression Level Optimization:

    • Challenge: Insufficient receptor expression

    • Solutions:

      • Optimize codon usage for expression system

      • Test multiple cell lines (HEK 293, CHO, etc.)

      • Use strong promoters (e.g., CMV, RSV)

      • Select cell lines expressing highest levels of receptor protein

  • Proper Membrane Trafficking:

    • Challenge: Receptors may not reach the cell surface

    • Solutions:

      • Verify surface expression using immunofluorescence

      • Add epitope tags (e.g., c-myc) to track localization

      • Consider fusion with trafficking enhancement sequences

  • Functional Coupling:

    • Challenge: Receptor may not couple efficiently to host cell G-proteins

    • Solutions:

      • Verify G-protein expression in host cells

      • Co-express appropriate G-protein subunits if necessary

      • Use multiple functional assays (cAMP, Ca2+ signaling)

  • Post-translational Modifications:

    • Challenge: Different glycosylation patterns may affect function

    • Solutions:

      • Compare binding properties with native receptors

      • Consider expression in invertebrate cell lines when possible

How can researchers address variability in experimental results when working with Aplysia tissues and primary cultures?

To address variability in Aplysia experimental systems:

  • Standardized Animal Husbandry:

    • Maintain consistent temperature, feeding, and light cycles

    • Document animal source, age, and weight

    • Consider seasonal variations in animal physiology

  • Tissue Preparation Consistency:

    • Standardize dissection techniques

    • Perform dissections at consistent times after feeding

    • Use defined enzyme mixtures and incubation times for cell dissociation

  • Culture Conditions:

    • Use serum-free media with defined supplements

    • Control temperature precisely

    • Maintain consistent plating densities

    • Allow standardized recovery time before experiments

  • Statistical Approaches:

    • Increase sample sizes to account for biological variability

    • Use paired designs when possible (each cell as its own control)

    • Consider hierarchical statistical analysis (animals, ganglia, cells)

    • Report variability measures alongside means

What alternative methodological approaches can overcome limitations in traditional biochemical and electrophysiological techniques for studying Aplysia 5-HT receptors?

Innovative methodological alternatives include:

  • Optical Methods:

    • Use fluorescent biosensors to detect cAMP or Ca2+ changes

    • Apply voltage-sensitive dyes to monitor membrane potential

    • Employ pH-sensitive fluorophores to track vesicle release

    • These approaches offer improved spatial and temporal resolution

  • Genetic Manipulation:

    • Apply CRISPR/Cas9 techniques for receptor modification

    • Use RNA interference to downregulate specific receptor subtypes

    • Develop transgenic Aplysia expressing modified receptors

    • These approaches allow more precise manipulation of receptor function

  • Computational Modeling:

    • Develop mathematical models of 5-HT receptor signaling

    • Simulate the effects of receptor activation on neural networks

    • Generate testable predictions about system behavior

    • These approaches can integrate data across multiple levels of analysis

  • High-Throughput Screening:

    • Develop cell-based assays for large-scale compound testing

    • Screen libraries for novel ligands with specific properties

    • Identify compounds with selective actions on different receptor subtypes

    • These approaches can accelerate discovery of useful experimental tools

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.