Recombinant Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Apocytochrome f (petA)

Recombinant Apocytochrome f (petA) refers to a form of the apocytochrome f protein that has been produced using recombinant DNA technology. Cytochrome f is a subunit of the cytochrome b6f complex, an integral membrane protein complex found in the thylakoid membranes of chloroplasts in plants, algae, and cyanobacteria, and it plays a crucial role in photosynthetic electron transport .

Apocytochrome f is the precursor to the mature cytochrome f protein, lacking the heme cofactor and signal peptide, which are essential for its function and localization within the photosynthetic electron transport chain . The petA gene encodes apocytochrome f . Recombinant production involves expressing the petA gene in a host organism, such as Escherichia coli, to produce the apocytochrome f protein in vitro .

Production and Expression

  1. Gene Isolation and Cloning: The petA gene, which encodes apocytochrome f, is isolated from an organism of interest (e.g., broad bean) . This gene is then amplified using PCR (polymerase chain reaction) with specific primers designed to incorporate restriction sites at the ends of the amplified DNA fragment .

  2. Expression Vector Construction: The amplified petA gene fragment is inserted into an expression vector, such as pTrc99A. This vector allows for high-level protein expression in a host organism .

  3. Host Organism Transformation: The expression vector containing the petA gene is transformed into a host organism like E. coli . The host cells are then cultured under conditions that promote the expression of the recombinant apocytochrome f.

  4. Induction of Expression: Gene expression is induced by adding a chemical inducer, such as isopropyl-1-thio-β-d-galactopyranoside (IPTG), to the culture medium . IPTG activates the promoter in the expression vector, leading to the transcription and translation of the petA gene.

  5. Protein Isolation: After induction, the cells are harvested, and the recombinant apocytochrome f protein is isolated and purified using various biochemical techniques, such as affinity chromatography or size-exclusion chromatography .

Role in Photosynthesis

Cytochrome f is a critical component of the cytochrome b6f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI) in the photosynthetic electron transport chain .

Research Findings

  • Catabolite Association: Research has shown that catabolites of cytochrome f, resulting from protein turnover, are associated with plastoglobuli and stromal lipid-protein particles within the chloroplast. These catabolites contain the transmembrane α-helix, indicating they are anchored in the thylakoid membrane .

  • Translational Control: The nuclear gene TCA1 (translation of cytochrome b6f petA mRNA) encodes a translational activator specific for petA mRNA in Chlamydomonas reinhardtii. Mutants lacking TCA1 are deficient in cytochrome f synthesis, highlighting the importance of translational control in regulating cytochrome f levels .

  • Expression Studies: Studies involving the expression of recombinant fragments of cytochrome f in E. coli have provided insights into the protein's structure, function, and interactions with other photosynthetic components .

Applications

  1. Biochemical Studies: Recombinant apocytochrome f is used in biochemical studies to investigate its structural and functional properties, including heme binding, electron transfer mechanisms, and interactions with other proteins .

  2. Structural Biology: Recombinant production allows for the preparation of cytochrome f for structural studies using techniques such as X-ray crystallography or cryo-electron microscopy, providing detailed insights into its three-dimensional structure.

  3. Photosynthetic Research: Recombinant apocytochrome f is employed to study the assembly and function of the cytochrome b6f complex, as well as its role in photosynthetic electron transport and energy production .

  4. Biotechnology: Genetically engineered algae or plants with modified petA genes can be created to enhance photosynthetic efficiency, potentially increasing biomass production and crop yields.

  5. Drug Discovery: Compounds targeting viral RNA-dependent RNA polymerase (RdRP) such as influenza A, disrupt PA-PB1 subunits interface with the best compounds characterized by cycloheptathiophene-3-carboxamide and 1,2,4-triazolo[1,5-a]pyrimidine-2-carboxamide .

Data Table

PropertyDescription
GenepetA
ProteinApocytochrome f
FunctionElectron transfer in photosynthesis
LocationThylakoid membrane (chloroplast)
CofactorHeme
Molecular WeightVaries depending on the presence of signal peptide and transmembrane domain
Expression HostEscherichia coli, other expression systems
Post-translational ModsHeme attachment, signal peptide cleavage
Related ComplexesCytochrome b6f complex
Associated ProteinsPlastoquinol, plastocyanin, other subunits of the cytochrome b6f complex
InhibitorsDisruptors of PA-PB1 subunits interface with the best compounds characterized by cycloheptathiophene-3-carboxamide and 1,2,4-triazolo$$1,5-a]pyrimidine-2-carboxamide (influenza A studies)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-313
Protein Length
Full Length of Mature Protein
Species
Mesostigma viride (Green alga)
Target Names
petA
Target Protein Sequence
YPIFAQQNYASPREATGRIVCANCHLAKKPVDIEVPQAVLPDTVFEAVVKIPYDTQVQQV LGNGKKGPLNVGAVLILPEGFKLAPQDRIPEEMKSKISNLYFQPYNAANENILVIGPIPG DKNREIVFPILSPDPAKDKGTYFIKYPISVGANRGRGQVYPDGSKSNNTVYNASVSGTIT DIIKEKKAYKISIETKDGTVVDTVPVGPELIVAKGDTVVTGQPITDNPNVGGFGQMDTEV VLQNPVRIKWLIAFLILSTLGQVFLVLKKKQFERVQIAESNF
Uniprot No.

Target Background

Function
Recombinant Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the structural organization of apocytochrome f and how does it relate to its maturation?

Apocytochrome f is synthesized as a precursor protein with a lumen-targeting peptide that drives translocation through the thylakoid membrane. The protein contains two critical cysteinyl residues responsible for covalent ligation of the c-type heme. Upon membrane insertion, the targeting peptide is cleaved, generating a mature N-terminus where the alpha-amino group of Tyr1 serves as one axial ligand of the c-heme, as revealed by crystallographic studies. The mature cytochrome f remains membrane-associated through a C-terminal-located α-helix .

Research methodology: Site-directed mutagenesis approaches targeting specific residues have been instrumental in elucidating structural requirements. For example, researchers have replaced the two cysteinyl residues responsible for covalent heme ligation with valine and leucine to study the impact on protein processing and function .

What experimental approaches best distinguish between apocytochrome f and holocytochrome f?

Two principal methods are effective for detecting mature holocytochrome f:

  • ECL detection - Relying on the pseudo-peroxidase activity of covalently bound heme

  • In-gel TMBZ staining - Visualizing heme-containing proteins directly in SDS-PAGE gels

Methodological approach: Separate proteins corresponding to 10–20 μg of chlorophyll on 12.5% acrylamide gels. For ECL detection, transfer to PVDF membrane at 100V (4°C) for 90 minutes and treat with ECL reagent. For TMBZ staining, soak the gel in 6.3 mM TMBZ dissolved in methanol in the dark, mixed with 1 M sodium acetate for 1–1.5 hours with periodic shaking. Blue bands revealing heme peroxidase activity appear after adding H₂O₂ to a final concentration of 30 mM .

Which expression systems are optimal for producing functional recombinant apocytochrome f?

Different expression systems offer distinct advantages:

Expression SystemAdvantagesConsiderationsBest Applications
E. coliHighest yields, Rapid production, Cost-effectiveLimited post-translational modificationsStructural studies, Antibody production
YeastGood yields, Some PTMs, Relatively fastMore complex than E. coliFunctional studies requiring some PTMs
Insect cellsMany PTMs, Better protein foldingLonger production time, More expensiveStudies requiring near-native protein
Mammalian cellsMost complete PTMs, Native-like foldingLowest yields, Most expensive, Longest timeFunctional studies requiring authentic PTMs

What is the relationship between protein processing and heme attachment during cytochrome f maturation?

Research has revealed that protein processing and heme attachment are independent events during cytochrome f maturation. Site-directed mutagenesis studies in Chlamydomonas reinhardtii have demonstrated that:

  • Substitution of cysteinyl residues responsible for heme binding (with valine and leucine) prevents heme attachment but does not inhibit processing of the precursor protein.

  • Modifying the consensus cleavage site for thylakoid processing peptidase (changing AQA to LQL) delays processing but doesn't prevent heme binding.

These findings indicate that pre-apocytochrome f can fold into suitable conformations for both heme lyase activity and assembly competence, regardless of its processing state .

What disulfide-reducing pathways are required for proper cytochrome f maturation?

Two key pathways have been identified:

  • CCS5-dependent pathway

  • CCS5-independent pathway (involving CCS4)

These pathways control the redox status of heme-binding cysteines in apocytochrome f. Experimental evidence shows that the double mutant ccs4Δccs5 completely blocks holocytochrome f assembly, while single mutants (Δccs5 or ccs4) retain partial functionality (approximately 10% and >2% holocytochrome f assembly, respectively) .

Methodological approach: Fluorescence transient analysis provides a non-invasive assessment of cytochrome b₆f functionality. In functional complexes, a rise in fluorescence followed by a decay phase is observed, while in mutants lacking holocytochrome f, a saturating rise with no decay occurs .

How is cytochrome f synthesis regulated at the translational level?

Cytochrome f synthesis is regulated through a feedback mechanism involving the 5' untranslated region (UTR) of petA mRNA. This constitutes a control by epistasy of synthesis (CES) process where:

  • Unassembled cytochrome f (specifically its C-terminal domain) represses its own synthesis.

  • Assembly partners influence cytochrome f synthesis rates.

Research has demonstrated this by replacing the petA promoter and 5' UTR with those from the atpA gene (encoding ATP synthase α subunit). This replacement abolished the assembly-dependent regulation, resulting in constitutive cytochrome f synthesis regardless of assembly partner availability .

What site-directed mutagenesis strategies have provided key insights into cytochrome f function?

Several mutagenesis approaches have proven valuable:

  • Heme-binding site mutations: Replacing cysteinyl residues (positions 52 and 55) with valine and leucine (F52L-55V strain) prevents heme attachment but allows protein processing, revealing that heme binding is not a prerequisite for processing .

  • Processing site mutations: Modifying the consensus cleavage site from AQA to LQL delays processing but permits heme binding and complex assembly, demonstrating that pre-holocytochrome f can adopt assembly-competent conformations .

  • Membrane anchor modifications: Studies comparing full-length and truncated versions (lacking the C-terminal membrane anchor) revealed that the membrane anchor down-regulates cytochrome f synthesis rates .

Methodological considerations: Chloroplast transformation using a petA gene encoding either full-length precursor protein or truncated versions provides an effective approach for introducing site-directed mutations in vivo .

How can researchers overcome challenges in studying cytochrome f assembly in vivo?

Several experimental approaches have proven valuable:

  • Chemical reduction: DTT treatment can partially rescue cytochrome f assembly defects in mutants with impaired disulfide-reducing pathways. The rescue effect is dose-dependent and correlates with restoration of cytochrome b₆f function .

  • Suppressor analysis: Studying spontaneous revertants (like SU9 and SU11 from ccs4Δccs5 strains) that recover photosynthetic proficiency provides insights into alternative pathways for cytochrome f assembly .

  • Fluorescence transient analysis: This non-invasive technique allows for rapid assessment of cytochrome b₆f functionality. In strains with functional complexes, a rise in fluorescence followed by a decay phase is observed, while in mutants lacking holocytochrome f, a saturating rise with no decay occurs .

What methods best assess the functional integration of holocytochrome f into the cytochrome b₆f complex?

A combination of approaches provides comprehensive assessment:

  • Photosynthetic growth phenotyping - Growth on minimal media under different light conditions

  • Fluorescence transient analysis - Measuring fluorescence rise and decay kinetics

  • Biochemical detection - Heme staining and immunoblotting

  • High light sensitivity testing - Assessing photosensitivity of mutants

Research data shows strong correlation between holocytochrome f assembly levels and photosynthetic function recovery. For example, in the SU9 suppressor strain, approximately 25% restoration of holocytochrome f assembly corresponds with partial recovery of photosynthetic proficiency, while SU11 shows near wild-type levels of both assembly and function .

How can researchers resolve contradictory findings about the requirements for cytochrome f maturation?

Experimental approaches to resolve contradictions include:

  • Genetic complementation - Introducing wild-type or mutant genes into different genetic backgrounds

  • Domain swapping - Creating chimeric proteins to identify functional regions

  • In vitro reconstitution - Studying isolated components under controlled conditions

For example, the discovery that CCS4 and CCS5 pathways are partially redundant for cytochrome f assembly resolved earlier contradictions about the absolute requirement for individual components. This was demonstrated by reconstructing suppressor strains by introducing mutant CCS4 genes into ccs4Δccs5 recipients and comparing them with wild-type complemented strains .

What remains unclear about heme attachment to apocytochrome f?

Despite significant progress, several aspects remain incompletely understood:

  • The precise molecular mechanism of heme lyase activity

  • How reducing pathways specifically target the CXXCH motif cysteines

  • The temporal coordination between membrane insertion, heme attachment, and processing

Recent evidence suggests CCS5/HCF164 can reduce disulfides at the CXXCH motif of apocytochrome f, but the complete pathway and its regulation remain active areas of investigation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.