Recombinant Apodemus mystacinus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction

Cytochrome c oxidase subunit 2 (MT-CO2) is a critical component of the mitochondrial respiratory chain, essential for energy production in eukaryotic cells. In Apodemus mystacinus, also known as the broad-toothed field mouse, MT-CO2 plays a vital role in cellular respiration. Recombinant MT-CO2 refers to the protein produced using recombinant DNA technology, allowing for detailed study and potential applications in understanding evolutionary relationships and physiological functions.

Background on Apodemus mystacinus

Apodemus mystacinus is a rodent species found throughout the Balkan Peninsula, Asia Minor, and the Middle East . Understanding its genetic makeup and molecular biology is crucial for studying its evolutionary history and adaptation to different environments .

Recombinant Production

Recombinant MT-CO2 is produced by cloning the MT-CO2 gene from Apodemus mystacinus into an expression vector, which is then introduced into a host organism such as E. coli or yeast. The host organism synthesizes the protein, which can then be purified for downstream applications.

Research Findings and Phylogenetic Analysis

Studies have used MT-CO2 sequences to investigate the phylogenetic relationships within the Apodemus genus . The genetic divergence observed in MT-CO2 sequences helps differentiate between species and subspecies, providing insights into their evolutionary history .

Table 1: Kimura two-parameter sequence divergence values

RegionWithin ApodemusWithin Sylvaemusmystacinus vs. Apodemusmystacinus vs. Sylvaemus
IRBP3.8%1.3%4.5%3.6%
12S rRNA5%2%5.2%4.8%
Cytochrome b6.8%4%8.8%8.8%

These values indicate the genetic distances between different groups, with cytochrome b showing that mystacinus is equidistant from Apodemus and Sylvaemus .

Table 2: Primers Used for Amplification of tRNA genes

PrimerSequence (5' to 3')Target Region
1ATAAACATTACTCTGGTCTTGTAAACtRNAThr and tRNAPro genes, part of the D-loop
2biCACAGTTATGGAAGTCTTGGtRNAThr and tRNAPro genes
3CGTTCCCCTAAATAAGACAD-loop central domain to the beginning of the 12S tRNA region
4TAATTATAAGGCCAGGACCABeginning of the 12S tRNA region

These primers are used to amplify specific regions of the mitochondrial genome, aiding in phylogenetic analysis and species identification .

Functional Studies

Recombinant MT-CO2 can be used to study the enzyme's function in vitro. These studies can provide insights into the enzyme kinetics, substrate specificity, and the effects of mutations on enzyme activity.

Applications in Conservation Biology

Understanding the genetic diversity and evolutionary relationships of Apodemus mystacinus is important for conservation efforts. MT-CO2 sequences can be used to identify distinct populations and assess the impact of habitat fragmentation and other environmental changes .

Metallothionein and Metal Homeostasis

While not directly MT-CO2 related, the broader context of metal homeostasis in wood mice (Apodemus) is relevant. Metallothionein (MT) plays a role in metal homeostasis and detoxification processes, serving as a useful biomarker for environmental monitoring .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Apodemus mystacinus (Broad-toothed field mouse)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAVILILIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKNFENWSTSMI
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprising Complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates a proton gradient across the inner mitochondrial membrane, driving ATP synthesis. MT-CO2 plays a crucial role in this process by participating in the reduction of oxygen to water within Complex IV. Electrons from reduced cytochrome c are transferred through the CuA center and heme A to the binuclear center (BNC), composed of heme a3 and CuB, where oxygen reduction occurs, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of MT-CO2 in Apodemus mystacinus and how does it compare to other rodent species?

MT-CO2 (Cytochrome c oxidase subunit 2) is a mitochondrial-encoded protein crucial for cellular respiration, responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase during ATP production. In Apodemus mystacinus (broad-toothed field mouse), as in other rodents, this protein is integral to the electron transport chain .

Methodological approach: To characterize functional differences between A. mystacinus MT-CO2 and other rodent species, researchers should:

  • Perform comparative sequence analysis across multiple rodent species

  • Identify conserved functional domains and variable regions

  • Use site-specific selection analysis to detect amino acid positions under evolutionary pressure

  • Employ biochemical assays measuring electron transfer efficiency under standardized conditions

Table 1: Expected Sequence Divergence Patterns in Rodent MT-CO2

Comparison LevelExpected Nucleotide DivergenceExpected Amino Acid DivergenceSelective Pressure
Within A. mystacinus populations<1%Nearly noneStrong purifying (ω << 1)
Between Apodemus species5-15%1-5%Primarily purifying with potential positive selection at interaction sites
Between rodent families15-25%5-15%Mixed, with functionally critical regions under purifying selection

What are the optimal conditions for expressing recombinant A. mystacinus MT-CO2?

Methodological answer: Successful expression requires addressing several challenges specific to mitochondrial-encoded proteins:

  • Codon optimization: Mitochondrial genetic code differs from standard nuclear code; therefore, sequence must be optimized for the chosen expression system

  • Expression system selection:

    • E. coli systems for structural studies (high yield but potential folding issues)

    • Insect cell systems for functional studies (better post-translational modifications)

    • Mammalian cell lines for interaction studies (most physiologically relevant)

  • Solubility enhancement: Use fusion partners (MBP, SUMO, or thioredoxin) and include appropriate detergents (n-dodecyl β-D-maltoside at 0.1-0.5%)

  • Temperature modulation: Lower induction temperature (16-18°C) often improves folding

How can I reliably detect selection pressure on specific amino acid sites in A. mystacinus MT-CO2?

Methodological answer: To detect site-specific selection in MT-CO2:

  • Sequence MT-CO2 from multiple A. mystacinus populations and closely related species

  • Align sequences using MUSCLE or MAFFT algorithms optimized for coding sequences

  • Apply codon-based maximum likelihood models to estimate ω (dN/dS ratio):

    • Site models (M1a vs M2a, M7 vs M8) to detect sites under positive selection

    • Branch-site models to identify lineage-specific selection

  • Validate statistically using likelihood ratio tests with appropriate degrees of freedom

  • Consider structural context of identified sites using homology modeling

This approach has successfully identified sites under positive selection in other species, including marine copepods where approximately 4% of COII codons showed evidence of relaxed selective constraint (ω = 1), while the majority were under strong purifying selection (ω << 1) .

What methodological approaches help distinguish between adaptive evolution and genetic drift in A. mystacinus MT-CO2 sequence variation?

Distinguishing between selection and drift requires multiple lines of evidence:

  • Statistical tests:

    • McDonald-Kreitman test comparing polymorphism and divergence patterns

    • HKA test examining diversity across multiple loci

    • Tajima's D and Fu & Li's F to detect departures from neutrality

  • Functional validation:

    • Site-directed mutagenesis of identified residues

    • Comparative biochemical assays (electron transfer efficiency, stability)

    • Protein-protein interaction analysis with nuclear-encoded partners

  • Geographic correlation:

    • Test for correlation between genetic variants and environmental variables

    • Control for population structure using neutral markers

Table 2: Interpreting Selection Test Results for MT-CO2

TestResultInterpretationFollow-up Analysis
ω > 1 at specific sitesPotential positive selectionStructural mapping and functional testing
ω = 1Neutral evolution/genetic driftPopulation genetic simulations
ω << 1Purifying selectionAssess functional importance
Significant MK testAdaptive evolutionIdentify causal environmental factors
Significant Tajima's DRecent selection or demographic changeTest additional loci to distinguish

What is the optimal experimental design for studying MT-CO2 sequence variation across A. mystacinus populations in relation to zoonotic disease prevalence?

Methodological answer: An effective experimental design would include:

  • Sampling strategy:

    • Collect samples from 10-15 geographic locations with varying disease prevalence

    • Minimum 15-20 individuals per location

    • Include both disease-positive and disease-negative individuals

    • Record ecological variables (habitat type, elevation, climate data)

  • Molecular analysis:

    • Sequence complete MT-CO2 gene using Sanger or NGS approaches

    • Screen for zoonotic pathogens (LCMV, hantavirus, etc.) using established PCR protocols

    • Sequence nuclear markers to control for population structure

  • Statistical framework:

    • Use generalized linear mixed models to test for associations between MT-CO2 variants and disease prevalence

    • Control for geographic distance, environmental factors, and population structure

    • Implement permutation tests to establish significance thresholds

  • Validation approaches:

    • Functional testing of identified variants in vitro

    • Prospective sampling in additional regions to test predictions

How can I address the challenge of co-amplifying nuclear pseudogenes (NUMTs) when targeting A. mystacinus MT-CO2?

Nuclear mitochondrial pseudogenes (NUMTs) can confound mitochondrial DNA studies. A methodological approach to address this includes:

  • Prevention strategies:

    • Use purified mitochondrial DNA when possible

    • Design primers in conserved regions flanking MT-CO2

    • Implement long-range PCR protocols that favor mitochondrial templates

    • Consider RNA-based approaches (RT-PCR) as NUMTs are typically non-transcribed

  • Detection methods:

    • Examine sequence chromatograms for double peaks

    • Clone amplicons and sequence multiple clones

    • Check for unexpected indels, stop codons, or frame shifts

    • Perform phylogenetic analysis of sequences to identify outliers

  • Validation approach:

    • Compare results from multiple tissue types (NUMTs can show tissue-specific patterns)

    • Use mitochondria-enriched preparations

    • Verify with different primer pairs

What methodological approaches are most effective for investigating interactions between recombinant A. mystacinus MT-CO2 and nuclear-encoded cytochrome c?

Methodological answer: A comprehensive investigation requires:

  • In vitro binding assays:

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis for interactions in near-native conditions

  • Structural approaches:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

    • Cryo-EM of reconstituted complexes

    • Cross-linking mass spectrometry to identify proximity relationships

  • Functional validation:

    • Electron transfer assays comparing wild-type and mutant variants

    • Oxygen consumption measurements in reconstituted systems

    • Site-directed mutagenesis of predicted interaction residues

Previous studies in other species have identified compensatory evolution between mitochondrial proteins and their nuclear partners, suggesting amino acid substitutions in MT-CO2 may evolve to maintain functional interactions with nuclear-encoded partners .

How can I resolve contradictory results between sequence-based predictions and experimental functional data for MT-CO2 variants?

When facing contradictions between computational predictions and experimental results:

  • Review methodological considerations:

    • Verify recombinant protein integrity (sequence, folding, modifications)

    • Ensure experimental conditions reflect physiological reality

    • Check for confounding variables in experimental setup

  • Expand analysis approaches:

    • Apply alternative computational algorithms with different theoretical frameworks

    • Increase sampling to improve statistical power

    • Consider epistatic interactions with other genetic elements

  • Integration framework:

    • Develop testable hypotheses to explain contradictions

    • Design experiments specifically targeting ambiguous results

    • Consider biochemical or structural reasons for unexpected results

Table 3: Troubleshooting Contradictory MT-CO2 Results

ObservationPotential CauseValidation Approach
Predicted deleterious variant functions normallyCompensatory mutation elsewhereSequence entire complex IV, test double mutants
Conserved sites tolerate substitutionsBiochemical redundancyTest function under varying conditions (pH, temperature)
Predicted neutral changes affect functionProtein-protein interaction disruptionExamine interactions with partner proteins
Population-specific functional differencesLocal adaptationCompare across environmental gradients

How can MT-CO2 sequence data be integrated with other genetic markers to resolve the evolutionary history of Apodemus mystacinus?

Methodological answer:

  • Data collection strategy:

    • Sequence MT-CO2 and 3-5 nuclear markers with varying evolutionary rates

    • Include samples across the species range

    • Add outgroup species (A. flavicollis, A. sylvaticus)

  • Analytical framework:

    • Perform separate phylogenetic analyses for each marker

    • Implement coalescent-based species tree methods (BEAST, *BEAST)

    • Test for topological congruence between markers

    • Apply molecular dating using appropriate calibration points

  • Conflict resolution:

    • Network analyses to visualize reticulate evolution

    • Tests for introgression using ABBA-BABA statistics

    • Explicit modeling of incomplete lineage sorting

  • Biological interpretation:

    • Correlate genetic patterns with paleogeographic events

    • Test hypotheses about dispersal corridors and barriers

    • Consider implications for zoonotic pathogen co-evolution

What statistical approaches are most appropriate for analyzing interpopulation divergence in MT-CO2 to identify potential cryptic species within A. mystacinus?

To detect cryptic species using MT-CO2 data:

  • Sequence divergence analysis:

    • Calculate uncorrected and model-corrected genetic distances

    • Apply standard thresholds while considering taxon-specific variation

    • Assess patterns of intra- versus inter-population divergence

  • Phylogenetic species delimitation:

    • Implement Bayesian (bPTP, GMYC) and distance-based methods

    • Validate with multi-locus approaches when possible

    • Apply coalescent-based species delimitation (BPP)

  • Population genetic structure:

    • AMOVA to partition genetic variation

    • Bayesian clustering methods (STRUCTURE, BAPS)

    • Isolation-by-distance versus isolation-by-barrier tests

Studies in other species have shown that interpopulation divergence at the COII locus can approach 20% at the nucleotide level with numerous nonsynonymous substitutions, suggesting potential for cryptic species identification .

What are the most reliable methods for extracting and amplifying MT-CO2 DNA from degraded A. mystacinus museum specimens?

Working with degraded museum specimens requires specialized approaches:

  • DNA extraction optimization:

    • Use silica-based extraction methods with extended digestion (24-48 hours)

    • Add carrier RNA to improve DNA recovery

    • Consider destructive sampling from tooth or bone material when tissue is unavailable

    • Implement strict anti-contamination protocols (dedicated workspace, negative controls)

  • PCR strategy:

    • Design multiple primer pairs targeting overlapping short fragments (100-200bp)

    • Increase cycle number (45-50 cycles) with touchdown protocols

    • Use high-fidelity polymerases with hot-start capabilities

    • Add PCR enhancers (BSA, DMSO) to overcome inhibitors

  • Sequencing approach:

    • Clone amplicons to resolve potential mixed templates

    • Consider capturing approaches for next-generation sequencing

    • Implement strict authentication criteria (reproducibility, damage patterns)

  • Data validation:

    • Compare with modern samples where available

    • Assess for contamination from model organisms and researchers

    • Examine molecular damage patterns consistent with ancient DNA

What approaches can help distinguish between adaptive convergence and shared ancestry when similar MT-CO2 variants appear in unrelated rodent lineages?

To differentiate between convergent evolution and shared ancestry:

  • Phylogenetic framework:

    • Reconstruct robust species phylogeny using multiple markers

    • Map MT-CO2 variants onto the species tree

    • Apply ancestral state reconstruction methods

    • Test for evolutionary rate heterogeneity

  • Molecular signature analysis:

    • Examine different codon positions and substitution patterns

    • Identify whether identical amino acids result from identical or different codons

    • Apply convergence detection algorithms (PCOC, CONVERG)

  • Structural and functional validation:

    • Map variants to protein structure

    • Determine if convergent sites cluster in functional domains

    • Test whether variants confer similar functional properties in different lineages

  • Environmental correlation:

    • Test for association between convergent variants and shared environmental factors

    • Control for phylogenetic signal using appropriate comparative methods

How can MT-CO2 genetic data be used to track potential transmission routes of zoonotic pathogens carried by A. mystacinus populations?

MT-CO2 sequence data can contribute to disease ecology studies through:

  • Population structure analysis:

    • Define distinct genetic populations/lineages of A. mystacinus

    • Map genetic structure against pathogen prevalence data

    • Identify potential barriers or corridors to host movement

  • Phylogeographic approaches:

    • Reconstruct historical population movements

    • Correlate host genetic diversity with pathogen genetic diversity

    • Test for co-divergence between host MT-CO2 and pathogen lineages

  • Practical implementation:

    • Develop MT-CO2 markers as a proxy for population identification

    • Establish database linking MT-CO2 haplotypes to pathogen prevalence

    • Create risk maps based on host genetic structure

This approach is particularly relevant as A. mystacinus has been identified as a potential carrier of zoonotic pathogens including various viruses documented in related rodent species .

What methodological considerations are important when designing studies to investigate potential correlations between MT-CO2 variants and susceptibility to specific pathogens?

A robust experimental design should include:

  • Sampling framework:

    • Case-control design comparing infected vs. uninfected individuals

    • Include representatives of all major MT-CO2 lineages

    • Control for age, sex, and geographical factors

    • Standardize pathogen detection methods

  • Genetic analysis approach:

    • Sequence complete MT-CO2 gene rather than fragments

    • Consider whole mitochondrial genome to capture linked variation

    • Include nuclear markers to control for population structure

    • Test specific variants and haplotypes rather than only broad lineages

  • Statistical rigor:

    • Calculate required sample sizes based on power analysis

    • Apply appropriate corrections for multiple testing

    • Control for population structure and geographic factors

    • Test alternative hypotheses (e.g., correlation with other ecological factors)

  • Functional validation:

    • Develop cellular models to test functional differences between variants

    • Consider immune response parameters in different genetic backgrounds

    • Test pathogen replication efficiency in different host genetic contexts

Table 4: Experimental Design Considerations for MT-CO2 and Pathogen Studies

Study ComponentCommon PitfallsRecommended Approach
SamplingGeographic sampling biasStratified sampling across regions
Pathogen detectionVariable sensitivity across methodsStandardized protocols with multiple targets
Genetic characterizationPartial gene sequencingComplete MT-CO2 and nuclear markers
Statistical analysisPseudoreplicationMixed models accounting for population structure
InterpretationCorrelation vs. causation confusionFunctional validation of associations

What bioinformatic pipeline is recommended for analyzing MT-CO2 sequence variation in large-scale population studies of A. mystacinus?

A comprehensive bioinformatic pipeline should include:

  • Sequence processing:

    • Quality filtering (Phred score >30, trimming of low-quality regions)

    • Assembly against reference or de novo assembly for novel variants

    • Alignment optimization with codon-aware algorithms

    • Manual verification of alignments, particularly at indel regions

  • Variant detection and annotation:

    • SNP/variant calling with appropriate thresholds

    • Annotation of variants (synonymous/nonsynonymous)

    • Prediction of functional impacts (SIFT, PolyPhen)

    • Haplotype reconstruction and phasing

  • Population genetic analyses:

    • Standard diversity metrics (π, θ, haplotype diversity)

    • Tests for selection (Tajima's D, Fu's Fs, dN/dS)

    • Population structure (FST, AMOVA, PCA)

    • Demographic reconstruction (Bayesian Skyline Plot, MSMC)

  • Visualization and data management:

    • Interactive maps of genetic variation

    • Haplotype networks

    • Standardized metadata capture

    • Database integration for collaborative research

How can contradictory signals between different analytical methods for MT-CO2 sequence data be resolved?

When different analytical methods yield contradictory results:

  • Methodological assessment:

    • Review assumptions of each method and potential violations

    • Assess sensitivity to parameter choices through systematic testing

    • Consider whether methods address the same biological question

    • Evaluate statistical power for each method given the available data

  • Data quality review:

    • Check for potential sequencing errors or sample contamination

    • Assess impact of missing data on different methods

    • Consider whether rare variants are driving differences

  • Reconciliation approaches:

    • Apply simulation-based validation to determine which method is most reliable

    • Develop consensus approaches incorporating multiple methods

    • Use hierarchical testing frameworks

    • Consider biological plausibility of different results

  • Reporting standards:

    • Transparently report all analyses, including contradictory results

    • Explicitly state methodological limitations

    • Present alternative interpretations of the data

    • Suggest critical experiments to resolve contradictions

This approach aligns with best practices in evolutionary genetics, where complex histories often require multiple analytical perspectives .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.