Recombinant Apodemus semotus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Apodemus semotus (Taiwan field mouse) (Formosan wood mouse)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISTLVLYIISLMLTTKLTHTSTMDAQE VETVWTILPAVILIMIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKHFENWSTSMI
Uniprot No.

Target Background

Function

Recombinant Apodemus semotus Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (Complex IV, CIV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis and transmembrane transport. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the CuA center (in subunit 2) and heme a (in subunit 1) to the binuclear center (BNC) in subunit 1. This BNC, comprised of heme a3 and CuB, reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO2 and what is its role in Apodemus semotus mitochondrial function?

MT-CO2 (Cytochrome c oxidase subunit 2) is a mitochondrially-encoded protein that forms a critical component of Complex IV in the electron transport chain, essential for cellular respiration and ATP production. In Apodemus semotus, as in other mammals, this protein plays a vital role in transferring electrons from cytochrome c to molecular oxygen, contributing to the generation of the proton gradient necessary for ATP synthesis. The gene encoding MT-CO2 is located in the mitochondrial genome and is subject to maternal inheritance patterns typical of mitochondrial DNA.

Variants in this gene, as observed in human studies, can lead to mitochondrial dysfunction resulting in neurological disorders such as cerebellar ataxia and neuropathy . In Apodemus species, MT-CO2 sequence analysis is valuable for phylogenetic studies and population genetics, similar to how other mitochondrial genes like cytochrome b (Cytb) have been used in related species such as Apodemus argenteus and Apodemus speciosus . Understanding the structure and function of MT-CO2 in Apodemus semotus provides insights into the evolutionary adaptations of this endemic Taiwanese species and serves as a model for studying mitochondrial genetics in isolated populations.

What are the standard methods for isolating mitochondrial DNA from Apodemus tissue samples?

Isolation of high-quality mitochondrial DNA from Apodemus tissue samples requires careful handling to minimize nuclear DNA contamination and preserve mitochondrial genome integrity. The process typically begins with tissue homogenization in an isolation buffer containing sucrose, EDTA, and protease inhibitors to protect the mitochondria during extraction. Differential centrifugation steps are then employed to separate mitochondria from other cellular components, followed by lysis of the mitochondrial membrane and purification of mtDNA.

For Apodemus species research, muscle or liver tissues are often preferred due to their high mitochondrial content, though studies have successfully used various tissue types including blood and buccal epithelia when working with mitochondrial genes . Commercially available extraction kits modified for mitochondrial DNA isolation can be utilized, but researchers should include additional purification steps to eliminate nuclear DNA contamination. Quality control measures should include spectrophotometric analysis (A260/A280 ratio) and gel electrophoresis to confirm mtDNA integrity before proceeding to amplification steps.

When working with field-collected or archival samples, methods may need modification to accommodate partially degraded tissues, with some researchers reporting success using nested PCR approaches similar to those employed for Cytb amplification in Apodemus argenteus and Apodemus speciosus studies . Regardless of the method chosen, careful documentation of tissue source, storage conditions, and extraction protocols is essential for ensuring reproducibility and accurate interpretation of results.

What PCR protocols are recommended for amplifying MT-CO2 from Apodemus semotus samples?

Amplification of MT-CO2 from Apodemus semotus samples benefits from a semi-nested PCR approach similar to that used for other mitochondrial genes in related Apodemus species. Based on protocols developed for Cytb amplification in Apodemus argenteus and Apodemus speciosus, researchers can adapt a two-stage PCR strategy . The initial amplification should use conserved primers flanking the MT-CO2 region, followed by a second PCR using internal primers specific to the target sequence.

The thermal cycling parameters should include an initial denaturation at 95°C for 10 minutes, followed by 30-35 cycles of 95°C for 30 seconds, annealing at 50-55°C for 30-60 seconds (optimized for primer specificity), and extension at 60-72°C for 30-60 seconds . The reaction mixture should contain appropriate buffer conditions, MgCl₂ concentration (typically 1.5-2.5 mM), dNTPs (200 μM each), primers (0.05-0.5 pmol/μl), and a high-fidelity DNA polymerase to minimize introduction of sequence errors during amplification.

When working with potentially degraded samples, shorter overlapping fragments may be targeted, or additional PCR optimization might be necessary, such as using DNA polymerases specifically designed for difficult templates (like AmpliTaq Gold DNA polymerase) . For quantitative analysis, researchers may consider developing real-time PCR assays similar to the pyrosequencing approaches used to quantify heteroplasmy in MT-CO2 variants . Regardless of the specific protocol, proper positive and negative controls should be included in each PCR run, and sequencing of both DNA strands is recommended to confirm the accuracy of the amplified product.

How does MT-CO2 in Apodemus semotus compare structurally to that in other rodent species?

The structural comparison of MT-CO2 across rodent species reveals patterns of conservation in functionally critical domains while highlighting species-specific variations that may reflect evolutionary adaptations. In Apodemus semotus, the MT-CO2 sequence exhibits high conservation in regions that form the catalytic core of cytochrome c oxidase, particularly in amino acid residues that directly interact with the heme groups and copper centers essential for electron transfer. These conserved features are shared with other Apodemus species, reflecting the fundamental importance of these domains for respiratory function.

Comparative analysis between Apodemus semotus and other well-studied rodents such as Mus musculus shows sequence variations primarily in non-critical regions, which may contribute to subtle differences in protein stability or interaction with other subunits of the complex. Similar patterns of conservation have been observed in studies of mitochondrial genes across Apodemus species, where coding regions maintain higher sequence similarity than non-coding regions . The transmembrane domains of MT-CO2 typically show greater conservation than external loops, consistent with the constraints imposed by the membrane environment and interaction with other complex IV components.

When examining MT-CO2 variation within the genus Apodemus, researchers have noted that species from isolated habitats like Apodemus semotus in Taiwan may exhibit distinctive sequence features reflecting genetic drift or adaptation to local environmental conditions. This is comparable to the population differentiation observed in Apodemus sylvaticus between different valleys, where genetic isolation has contributed to increased genetic diversity . Analysis of selective pressure on the MT-CO2 gene through calculation of nonsynonymous to synonymous substitution ratios can provide insights into the evolutionary forces shaping this protein across rodent species, with implications for understanding mitochondrial adaptation in different ecological contexts.

What techniques are available for verifying the authenticity of amplified MT-CO2 sequences?

Verification of MT-CO2 sequence authenticity is a critical step in ensuring research validity, particularly when working with novel or rare species like Apodemus semotus. The primary verification method involves bidirectional Sanger sequencing of PCR products using the universal primers (such as M13RP1 and -21 M13) or the PCR primers themselves, similar to approaches used for other mitochondrial genes in Apodemus species . This dual-direction sequencing allows researchers to confirm sequence accuracy by comparing overlapping regions and identifying any discrepancies that might indicate sequencing artifacts or contamination.

Sequence authentication should also include rigorous bioinformatic analysis, beginning with quality assessment of chromatograms to ensure clean, high-confidence base calls. The obtained sequences should be aligned using programs like ClustalW implemented in MEGA5 or similar software to identify any unusual insertions, deletions, or substitutions that might indicate nuclear mitochondrial DNA segments (NUMTs) rather than authentic mitochondrial sequences . Comparison with published MT-CO2 sequences from related Apodemus species provides an additional verification step, as legitimate sequences will show expected levels of conservation in functionally critical regions while displaying species-specific variations in less constrained domains.

For studies involving novel MT-CO2 variants, additional verification steps may be necessary, such as cloning and sequencing multiple independent clones to rule out PCR artifacts, or using long-range PCR to amplify larger mitochondrial fragments that include MT-CO2 along with adjacent genes to confirm mitochondrial origin. Quantitative analysis of heteroplasmy using techniques like pyrosequencing can provide further validation by characterizing the distribution of variants across different tissues from the same individual, as authentic mitochondrial variants often show tissue-specific segregation patterns . Finally, functional verification through expression studies or conservation analysis can provide biological context for the identified sequences, particularly when novel variants or previously uncharacterized species are involved.

What expression systems are most appropriate for producing functional recombinant Apodemus semotus MT-CO2?

Selection of an appropriate expression system for recombinant Apodemus semotus MT-CO2 production must address several challenges inherent to mitochondrial membrane proteins. Bacterial expression systems (such as Escherichia coli) offer simplicity and high yield but often struggle with proper folding of eukaryotic membrane proteins, frequently resulting in inclusion bodies that require complex refolding procedures. Yeast systems (Saccharomyces cerevisiae or Pichia pastoris) provide a eukaryotic environment more conducive to correct folding while maintaining relatively high expression levels and have proven successful for other mitochondrial proteins.

Insect cell expression systems utilizing baculovirus vectors represent an excellent compromise for MT-CO2 expression, offering sophisticated eukaryotic protein processing machinery while providing good yields. Mammalian cell lines (particularly those with reduced endogenous MT-CO2 expression) can be employed when authentic post-translational modifications and proper membrane insertion are critical for downstream functional studies. For any expression system, codon optimization of the MT-CO2 sequence for the host organism is essential to enhance expression efficiency, as mitochondrial genes use a genetic code that differs slightly from the standard nuclear code.

The expression construct design should include appropriate targeting sequences to direct the recombinant protein to the correct subcellular location (mitochondrial inner membrane for functional studies, or without targeting sequences for biochemical characterization), along with affinity tags (such as His6 or FLAG) positioned to minimize interference with protein function. When co-expression with other cytochrome c oxidase subunits is necessary for proper assembly and function, multi-protein expression systems may be required, similar to approaches used for recombinant cytochrome P450 enzymes that benefit from co-expression with cytochrome b5 . Regardless of the chosen system, expression conditions should be carefully optimized and monitored using western blotting, activity assays, and spectroscopic methods to confirm proper folding and incorporation of essential cofactors.

How can researchers assess the functionality of recombinant MT-CO2 in vitro?

Assessing the functionality of recombinant Apodemus semotus MT-CO2 requires a multi-faceted approach that evaluates both structural integrity and enzymatic activity. The primary functional assay measures cytochrome c oxidase activity through spectrophotometric monitoring of cytochrome c oxidation, tracking the decrease in absorbance at 550 nm as reduced cytochrome c is oxidized. This assay should be performed with appropriate controls including known active cytochrome c oxidase preparations and inhibition studies using specific inhibitors like potassium cyanide to confirm specificity of the observed activity.

Proper incorporation of metal cofactors (copper centers) essential for MT-CO2 function can be assessed through electron paramagnetic resonance (EPR) spectroscopy and UV-visible spectroscopy to characterize the coordination environment and redox properties of these centers. Membrane integration and protein folding can be evaluated using circular dichroism spectroscopy to analyze secondary structure, while thermal stability assays provide insights into protein robustness. When recombinant MT-CO2 is integrated into proteoliposomes or nanodiscs, proton pumping activity can be measured using pH-sensitive fluorescent dyes or direct electrochemical methods to assess the protein's ability to contribute to proton gradient formation.

For more detailed functional characterization, oxygen consumption measurements using polarographic methods (such as Clark-type electrodes) or fluorescence-based oxygen sensing provide direct assessment of the recombinant protein's catalytic efficiency. Successful functional reconstitution may require co-expression or addition of other cytochrome c oxidase subunits, similar to how cytochrome P450 enzymes benefit from enrichment with cytochrome b5 for optimal activity . The development of high-throughput screening methods using fluorogenic substrates, comparable to those used for cytochrome P450 enzymes, could expedite functional analysis of multiple MT-CO2 variants, allowing researchers to correlate sequence variations with differences in enzymatic properties or stability.

What methodologies are recommended for studying the effects of MT-CO2 mutations on protein function?

Studying the functional consequences of MT-CO2 mutations requires a comprehensive workflow beginning with strategic selection of mutations based on evolutionary conservation analysis, structural predictions, and known pathogenic variants in related species. Site-directed mutagenesis techniques, using overlap extension PCR or commercially available kits, provide precise introduction of desired mutations into expression constructs. For analyzing multiple variants, a systematic mutation scanning approach may be employed to create a library of mutants covering functionally significant regions of the protein.

Expression and purification of mutant proteins should follow standardized protocols to ensure consistent yields and purity across all variants, facilitating direct comparisons of functional parameters. Enzymatic activity assays measuring cytochrome c oxidation rates, oxygen consumption, and proton pumping efficiency should be conducted under identical conditions for wild-type and mutant proteins, with data normalized to protein concentration to calculate specific activities. Thermal stability and unfolding profiles can reveal subtle structural changes that might not affect baseline activity but could impact protein resilience under stress conditions.

When studying potentially pathogenic mutations, integration of biochemical data with clinical or phenotypic information is essential, similar to approaches used for human MT-CO2 variants where muscle biopsy findings were correlated with genetic analysis and clinical presentation . Single-fiber analysis techniques, adapted from human studies, can be applied to Apodemus tissue samples to assess the segregation patterns and threshold effects of heteroplasmic mutations . Computational modeling and molecular dynamics simulations provide additional layers of analysis for predicting mutation effects on protein structure, subunit interactions, and electron transfer pathways. This multi-modal approach allows researchers to establish causative relationships between specific amino acid changes and observed functional deficits, contributing to our understanding of structure-function relationships in MT-CO2 across species.

How can heteroplasmy in MT-CO2 variants be accurately quantified in Apodemus semotus tissues?

Accurate quantification of heteroplasmy (the coexistence of multiple mitochondrial DNA variants within a single cell or tissue) in MT-CO2 requires sensitive and precise methodologies adapted from human mitochondrial disease research. Pyrosequencing represents a gold standard approach, as demonstrated in human MT-CO2 variant studies where this technique reliably detected heteroplasmy levels as low as 3% . For Apodemus semotus research, a similar assay can be developed using the PyroMark platform with variant-specific primers designed to target the regions of interest in the MT-CO2 gene.

Digital droplet PCR (ddPCR) offers another powerful approach for heteroplasmy quantification, providing absolute quantification of mutant and wild-type molecules without requiring a standard curve. This method is particularly valuable for low-frequency variants or when sample material is limited. Next-generation sequencing (NGS) methodologies, including targeted deep sequencing of MT-CO2, enable comprehensive detection of all variants within a sample while providing quantitative data on their relative abundances. The choice between these methods should consider factors such as the expected heteroplasmy range, required precision, available sample quantity, and access to specialized equipment.

Tissue-specific heteroplasmy patterns provide critical insights into the segregation and potential phenotypic impact of MT-CO2 variants. Following approaches used in human studies, researchers should analyze multiple tissues from the same Apodemus semotus individual (skeletal muscle, urinary sediments, blood, and buccal epithelia) to characterize variant distribution patterns . For more detailed analysis, laser-capture microdissection of individual muscle fibers can be employed to isolate specific cell populations (such as COX-deficient versus COX-positive fibers) for heteroplasmy assessment . This single-cell approach reveals threshold effects and cellular selection pressures acting on particular variants. Familial studies examining heteroplasmy across generations of related Apodemus individuals can further illuminate inheritance patterns and potential germline selection, contributing valuable data to our understanding of mitochondrial genetics in this species.

What bioinformatic tools are most useful for analyzing MT-CO2 sequence evolution in Apodemus species?

Bioinformatic analysis of MT-CO2 evolution in Apodemus species requires a specialized toolkit that integrates multiple analytical approaches. Sequence alignment tools such as ClustalW implemented in MEGA5 provide the foundation for comparative analysis, allowing precise alignment of MT-CO2 sequences across Apodemus species and other rodents . These alignments enable identification of conserved domains that likely face strong selective constraints versus more variable regions potentially subject to adaptive evolution. For more refined alignments of difficult regions, tools like MUSCLE or T-Coffee may offer improved accuracy, particularly for comparing sequences with insertions or deletions.

Phylogenetic analysis software including MEGA, MrBayes, and RAxML enables construction of evolutionary trees to visualize relationships between MT-CO2 sequences from different Apodemus species and populations. These analyses benefit from appropriate model selection (typically using programs like ModelTest or jModelTest) to identify the best-fitting evolutionary model for MT-CO2 sequence data. Population genetics software such as DnaSP and Arlequin allows calculation of nucleotide diversity, haplotype diversity, and tests for selective pressure (dN/dS ratios), providing insights into the evolutionary forces shaping MT-CO2 variability within and between Apodemus populations.

For structural interpretation of sequence variations, homology modeling tools like SWISS-MODEL or Phyre2 can generate three-dimensional models of Apodemus MT-CO2 based on crystallographic data from related species, allowing visualization of where variable residues map onto the protein structure. For more advanced analysis, PAML (Phylogenetic Analysis by Maximum Likelihood) enables detection of sites under positive selection, while Bayesian skyline plot analyses in BEAST can reconstruct historical population dynamics based on MT-CO2 sequence data. These approaches have proven valuable in studies of other Apodemus species, revealing patterns of genetic differentiation between populations from different geographic regions similar to what might be expected for Apodemus semotus as an island endemic species . Integration of these various bioinformatic approaches provides a comprehensive picture of MT-CO2 evolution in the context of Apodemus speciation and adaptation.

What are the optimal tissue sampling and preservation methods for MT-CO2 studies in Apodemus semotus?

Effective tissue sampling and preservation represent critical first steps in Apodemus semotus MT-CO2 research, directly impacting downstream molecular analyses. For field collection, liver and skeletal muscle tissues are preferred due to their high mitochondrial content, though heart, kidney, and brain tissues also provide excellent sources of mitochondrial DNA. Multiple tissue types should be collected whenever possible to enable studies of tissue-specific heteroplasmy patterns, as demonstrated in human MT-CO2 research where variant distributions were compared across skeletal muscle, urinary sediments, blood, and buccal epithelia . Non-invasive samples (buccal swabs, hair follicles) may be collected from live animals when sacrifice is not possible or ethical approval limits tissue collection.

Preservation methods must balance mitochondrial integrity with field practicality. Flash-freezing in liquid nitrogen provides optimal preservation for functional studies and enzyme assays, while RNA-later or similar stabilization solutions offer good DNA/RNA preservation at ambient temperatures when immediate freezing isn't feasible. For histological and immunohistochemical analyses of MT-CO2 distribution within tissues, samples should be fixed in 10% neutral buffered formalin or preserved for frozen sectioning depending on the planned staining protocols. Regardless of method, samples should be processed quickly after collection to minimize degradation, with detailed records kept of time elapsed between animal death and tissue preservation.

Sample storage conditions significantly impact long-term viability for molecular studies. For extended storage, tissues should be maintained at -80°C, with samples intended for RNA work kept at even lower temperatures when possible. Repeated freeze-thaw cycles must be avoided by aliquoting samples appropriately before freezing. When planning field expeditions for Apodemus semotus collection, researchers should develop detailed sampling protocols that address these preservation requirements while considering the logistical constraints of the collection environment. Similar approaches have been successfully employed in field studies of other Apodemus species, such as the 13-year monitoring study of Apodemus sylvaticus populations in Malham Tarn, Yorkshire, which yielded valuable samples for parasitological and genetic analyses .

How can single-fiber segregation studies be adapted for Apodemus semotus MT-CO2 research?

Single-fiber segregation analysis represents a powerful approach for studying mitochondrial DNA variants that can be adapted from human research to Apodemus semotus MT-CO2 studies. The methodology begins with histochemical staining of muscle cross-sections for cytochrome c oxidase (COX) activity, allowing visual identification of COX-deficient and COX-positive fibers that may harbor different levels of MT-CO2 variants. These differentially functioning fibers can then be isolated using laser-capture microdissection, a technique successfully employed in human MT-CO2 variant studies to separate individual muscle fibers for genetic analysis .

Following fiber isolation, DNA extraction must be optimized for the minute quantities obtained from single fibers, typically using specialized micro-extraction protocols that minimize sample loss. Quantitative PCR-based assays, such as the pyrosequencing approach used to measure heteroplasmy levels in human MT-CO2 variants, can then be applied to these samples to determine the precise level of variant load in each fiber type . This method allows researchers to establish the relationship between mutation load and biochemical defects at the single-cell level, providing insights into threshold effects and cellular selection pressures.

The correlation between MT-CO2 variant levels and biochemical phenotypes across different fibers creates a functional map of mitochondrial mosaicism within tissues. This approach can be particularly valuable for understanding the tissue-specific manifestations of MT-CO2 variants in Apodemus semotus, potentially revealing how selection pressures at the cellular level influence the distribution and maintenance of mitochondrial genetic diversity within an individual. Comparative analysis with related species could further illuminate how selection pressures differ across ecological contexts, contributing to our understanding of mitochondrial adaptation in rodents. When combined with other techniques like immunohistochemistry for mitochondrial proteins or in situ hybridization, single-fiber studies provide a comprehensive picture of how MT-CO2 variants influence cellular energy metabolism in different tissue environments.

What expression vector designs maximize recombinant MT-CO2 yield and functionality?

Optimal expression vector design for recombinant Apodemus semotus MT-CO2 production requires careful consideration of multiple elements that influence protein expression, folding, and function. The promoter selection should match the chosen expression system, with strong inducible promoters (such as T7 for bacterial systems, AOX1 for Pichia pastoris, or CMV for mammalian cells) allowing tight control over expression timing and intensity. For mitochondrial membrane proteins like MT-CO2, moderate expression levels often yield better results than maximum overexpression, as they reduce the burden on cellular folding machinery and minimize aggregation.

The inclusion of appropriate targeting signals significantly impacts both yield and functionality of recombinant MT-CO2. For functional studies requiring mitochondrial localization, the vector should include a mitochondrial targeting sequence, potentially derived from the host organism rather than Apodemus to ensure efficient import. Alternatively, for structural studies or in vitro reconstitution, vectors can be designed without targeting sequences but with additions that facilitate membrane insertion or solubilization. Affinity tags for purification (His6, FLAG, or Strep-tag II) should be positioned at termini less likely to interfere with function, with TEV or PreScission protease cleavage sites included to allow tag removal after purification.

Codon optimization for the expression host is particularly important for mitochondrial genes like MT-CO2, which naturally use a genetic code that differs slightly from the standard nuclear code. Vector elements that enhance mRNA stability and translation efficiency, such as optimal Kozak sequences and appropriate 5' and 3' untranslated regions, further improve expression yields. For co-expression with partner proteins or additional cytochrome c oxidase subunits, dual-promoter vectors or co-transfection strategies can be employed, similar to approaches used for enriching recombinant cytochrome P450 enzymes with cytochrome b5 . To facilitate screening of multiple constructs, the inclusion of reporter genes (such as GFP fusions) can provide rapid assessment of expression levels and subcellular localization. Systematic testing of these vector design elements through small-scale expression trials allows optimization before scaling up to production quantities for downstream applications.

What purification strategies yield the highest quality recombinant MT-CO2 for functional studies?

Purification of recombinant Apodemus semotus MT-CO2 for functional studies presents unique challenges due to its hydrophobic nature and requirement for proper cofactor integration. The purification workflow should begin with careful cell disruption methods that preserve membrane integrity, such as gentle mechanical homogenization or specialized detergent-based lysis buffers designed for membrane proteins. Initial separation of membrane fractions through differential centrifugation enriches the starting material for subsequent steps, similar to the preparation of microsomal fractions used for cytochrome P450 studies .

Solubilization represents a critical step where detergent selection significantly impacts protein stability and activity. Mild non-ionic detergents (DDM, LMNG, or digitonin) or amphipols are preferred for maintaining MT-CO2 in a native-like environment throughout purification. Affinity chromatography utilizing engineered tags (His6, FLAG, or Strep-tag II) provides the primary capture step, with conditions optimized to minimize non-specific binding while maximizing recovery of the target protein. For applications requiring removal of the affinity tag, on-column or post-elution proteolytic cleavage can be performed, followed by a reverse affinity step to separate the cleaved protein from uncleaved material.

Further purification through ion exchange and size exclusion chromatography improves sample homogeneity by separating different oligomeric states and removing contaminants with similar affinity properties. Throughout the purification process, the presence of appropriate stabilizers (such as specific lipids, glycerol, or cofactors) helps maintain protein integrity. Quality assessment of the purified recombinant MT-CO2 should include SDS-PAGE, western blotting, mass spectrometry for identity confirmation, and spectroscopic analysis to verify cofactor incorporation. Functional validation through activity assays, similar to those used for cytochrome P450 enzymes involving NADPH consumption and fluorogenic substrate conversion , provides the ultimate measure of purification success. For structural biology applications, additional criteria including monodispersity (assessed by dynamic light scattering) and thermal stability (measured by differential scanning fluorimetry) help identify preparations most likely to yield high-resolution structural data.

What controls and standards are essential for enzymatic assays involving recombinant MT-CO2?

Rigorous controls and standards form the foundation of reliable enzymatic assays for recombinant Apodemus semotus MT-CO2, ensuring data reproducibility and valid interpretation. Positive controls should include commercially available cytochrome c oxidase preparations or mitochondrial fractions with known activity levels, providing benchmarks for assay performance and facilitating normalization across experiments. Negative controls must address both enzymatic and non-enzymatic contributions to observed activity, including assays performed in the presence of specific inhibitors (such as potassium cyanide or sodium azide) to confirm signal specificity, and heat-inactivated enzyme preparations to account for non-catalytic background rates.

Standard curves using purified cytochrome c at varying concentrations establish the linear range and sensitivity of spectrophotometric assays, while titration of recombinant MT-CO2 confirms that reaction rates correlate with enzyme concentration as expected for a well-behaved catalytic system. Time-course measurements verify reaction linearity within the selected assay duration, preventing artifacts from substrate depletion or product inhibition. Buffer composition controls, including variations in pH, ionic strength, and detergent concentration, help identify optimal conditions for enzyme activity while revealing potential sources of variability between experiments.

For heterologous expression systems, appropriate empty vector controls processed through identical purification procedures help distinguish genuine MT-CO2 activity from background contributions of the expression host. When studying the influence of potential regulatory factors or protein partners on MT-CO2 function, titration experiments with these components (similar to the cytochrome b5 enrichment approach used for cytochrome P450 enzymes ) provide quantitative insights into interaction effects. Stability controls monitoring activity retention during storage under various conditions guide sample handling protocols for maximum reproducibility. Finally, inter-laboratory validation using standardized assay protocols and reference materials enables meaningful comparison of results across research groups, fostering collaborative advancement in the field of Apodemus mitochondrial research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.