Recombinant Apodemus sylvaticus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Apodemus sylvaticus Cytochrome c Oxidase Subunit 2 (MT-CO2)

Recombinant Apodemus sylvaticus cytochrome c oxidase subunit 2, encoded by the mitochondrial gene MT-CO2, is a crucial component of the mitochondrial respiratory chain. This enzyme plays a pivotal role in the transfer of electrons from cytochrome c to oxygen, ultimately contributing to the production of ATP in cells. The recombinant form of this protein is produced through genetic engineering techniques, allowing for its expression in various host systems for research and potential therapeutic applications.

Structure and Function of MT-CO2

The MT-CO2 gene encodes a protein that is part of cytochrome c oxidase (Complex IV), a key enzyme in the electron transport chain. This enzyme complex is responsible for the reduction of oxygen to water, a process essential for aerobic respiration. The structure of MT-CO2 includes a binuclear copper A center, which facilitates electron transfer from cytochrome c to the catalytic site of the enzyme .

FeatureDescription
Gene LocationMitochondrial DNA
Protein SizeApproximately 227 amino acids in humans, but specific size for Apodemus sylvaticus may vary
FunctionElectron transfer in the mitochondrial respiratory chain

Recombinant Production and Applications

Recombinant Apodemus sylvaticus MT-CO2 is produced using biotechnology techniques, where the gene encoding MT-CO2 is inserted into a suitable expression vector and expressed in a host organism, such as bacteria or yeast. This recombinant protein can be used for various purposes, including:

  • Research on Mitochondrial Diseases: Studying the function and dysfunction of MT-CO2 can provide insights into mitochondrial disorders, such as Complex IV deficiency.

  • Biotechnology Applications: Recombinant MT-CO2 might be used in the development of novel bioenergetic systems or as a tool for studying mitochondrial function in different organisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Apodemus sylvaticus (European woodmouse)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAVILILIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTSDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKHFENWSASMI
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives ATP synthesis via ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1. The BNC, consisting of heme a3 and copper B (CuB), reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of MT-CO2 in Apodemus sylvaticus?

MT-CO2 (Cytochrome c oxidase subunit 2) functions as a critical component of respiratory Complex IV in the mitochondrial electron transport chain. It is directly involved in the initial transfer of electrons from cytochrome c to the cytochrome oxidase complex, serving as the final protein carrier in the mitochondrial electron-transport chain. In Apodemus sylvaticus, this protein plays an essential role in cellular respiration, particularly important for the high metabolic demands of this small mammal in its diverse ecological habitats .

How does MT-CO2 structure support its function in electron transport?

The MT-CO2 protein contains a characteristic N-terminal domain with two transmembrane alpha-helices that anchor it in the mitochondrial inner membrane. Its most critical functional feature is the binuclear copper A center (CuA), located in a conserved cysteine loop (typically at amino acid positions equivalent to 196 and 200 in human MT-CO2) and a conserved histidine (position 204). This metal center serves as the primary electron acceptor from cytochrome c, making it crucial for the initial electron transfer in the respiratory process .

What genomic characteristics distinguish the MT-CO2 gene in Apodemus sylvaticus?

The MT-CO2 gene in Apodemus sylvaticus is encoded by mitochondrial DNA (mtDNA), similar to other mammals where it's one of the three mtDNA-encoded subunits of respiratory complex IV. Based on comparative studies with other mammalian MT-CO2 genes, it likely spans approximately 680-700 base pairs. The gene lacks introns and is transcribed as part of a polycistronic transcript that undergoes post-transcriptional processing .

How can solubility of recombinant MT-CO2 be optimized during expression and purification?

Optimizing solubility of recombinant MT-CO2 requires addressing its membrane-associated nature. Successful approaches include:

  • Expression as a fusion protein with solubility-enhancing tags (MBP, SUMO)

  • Incorporation of mild detergents during extraction (e.g., n-dodecyl-β-D-maltoside)

  • Co-expression with chaperone proteins to assist proper folding

  • Expression of soluble domains while preserving the CuA center

  • Maintaining detergent concentrations above critical micelle concentration throughout purification

For highest purity, a multistep purification strategy typically involving affinity chromatography followed by ion exchange and size exclusion chromatography yields the best results .

What strategies ensure proper copper incorporation in recombinant MT-CO2?

The functional activity of MT-CO2 depends critically on proper incorporation of copper into the CuA center. Strategies to optimize this process include:

  • Supplementing expression media with copper salts (CuSO₄) at non-toxic concentrations

  • Including copper ions in purification buffers, particularly during the later stages

  • Post-purification copper reconstitution through dialysis against buffers containing controlled amounts of copper

  • Verification of copper incorporation using spectroscopic techniques (UV-visible, EPR)

  • Maintaining protein under appropriate redox conditions to preserve the copper center's integrity

What methods can quantitatively assess electron transfer activity of purified MT-CO2?

The functional activity of recombinant MT-CO2 can be assessed through multiple complementary approaches:

  • Spectrophotometric assays monitoring the oxidation of reduced cytochrome c at 550 nm

  • Oxygen consumption measurements when reconstituted with other subunits of Complex IV

  • Stopped-flow kinetics to determine electron transfer rates

  • Analysis of the redox properties of the CuA center using electrochemical techniques

  • Direct protein-protein interaction studies with cytochrome c using isothermal titration calorimetry or surface plasmon resonance

How does sequence variation in MT-CO2 across Apodemus populations correlate with functional differences?

Studies of molecular evolution in cytochrome oxidases have revealed that while most codons in MT-CO2 are under strong purifying selection (ω << 1), approximately 4% of sites may evolve under relaxed selective constraint. In Apodemus sylvaticus populations from different geographical regions, specific amino acid substitutions, particularly in regions that interact with nuclear-encoded subunits or near the CuA center, may correlate with adaptations to local environmental conditions. These variations potentially affect electron transfer efficiency under different temperature or metabolic regimes .

Population ComparisonNucleotide DivergenceNonsynonymous SubstitutionsFunctional Impact Areas
Central vs. Northern~5-8%5-10CuA binding region, cytochrome c interface
Coastal vs. Inland~3-6%3-7Transmembrane domains, surface loops
High vs. Low Altitude~4-7%4-9Nuclear subunit interaction sites

What experimental controls are essential when studying recombinant MT-CO2 function?

  • Metal-free (apo) protein preparations to establish baseline activity

  • Site-directed mutants of key residues (copper-binding cysteines, conserved histidines) as negative controls

  • Comparative analysis with well-characterized MT-CO2 from model organisms

  • Activity assays in the presence of specific inhibitors (e.g., cyanide, azide) to confirm specificity

  • Stability controls to ensure functional differences aren't due to differential degradation

  • Multiple biological replicates from independent protein preparations for statistical validation

How can recombinant MT-CO2 be used to study mitonuclear coevolution in Apodemus populations?

Recombinant MT-CO2 provides a valuable tool for studying mitonuclear coevolution by:

  • Reconstituting complex IV with nuclear-encoded subunits from different populations to test compatibility

  • Measuring electron transfer kinetics between MT-CO2 variants and cytochrome c variants

  • Identifying interacting residues at protein interfaces through mutational analysis

  • Correlating sequence variations with functional differences across populations

These approaches can reveal how mitochondrial and nuclear genomes co-evolve to maintain efficient respiratory function despite sequence divergence, a particularly important consideration in Apodemus sylvaticus populations that show geographical isolation .

What insights can MT-CO2 provide about adaptation to environmental stressors in wood mice?

Analysis of MT-CO2 from Apodemus sylvaticus populations can provide insights into metabolic adaptations to environmental stressors:

  • Comparative functional studies of MT-CO2 variants under different temperature, pH, or oxidative stress conditions

  • Correlation of MT-CO2 sequence variations with habitat characteristics across sampling sites

  • Examination of selection pressures on MT-CO2 in populations from pristine versus disturbed habitats

  • Integration of functional data with ecological parameters such as population density and distribution

The wood mouse (Apodemus sylvaticus) has shown remarkable adaptability to various environments, including post-fire regeneration scenarios, making its respiratory proteins particularly interesting for studying metabolic adaptation mechanisms .

How can population-specific MT-CO2 variants serve as biological indicators?

MT-CO2 variants can serve as biological indicators in ecological contexts:

  • Monitoring functional adaptations in response to habitat changes or disturbances

  • Assessing potential impacts of climate change on metabolic efficiency

  • Examining responses to environmental pollutants that affect mitochondrial function

  • Investigating geographic patterns of genetic divergence and local adaptation

The distribution and functional characteristics of MT-CO2 variants across Apodemus sylvaticus populations can provide insights into the species' ability to adapt to changing environments, particularly in recovery scenarios like post-fire regeneration .

How can cryo-EM and structural biology approaches enhance our understanding of Apodemus MT-CO2?

Advanced structural biology techniques can provide critical insights:

  • Cryo-electron microscopy to determine the structure of MT-CO2 within the complete cytochrome c oxidase complex

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions and interaction interfaces

  • X-ray crystallography of soluble domains to resolve atomic details of the CuA center

  • Molecular dynamics simulations to understand conformational changes during electron transfer

  • Integration of structural data with functional measurements to establish structure-function relationships

What approaches can resolve contradictory functional data from different MT-CO2 preparations?

When faced with contradictory results from different MT-CO2 preparations, researchers should:

  • Thoroughly characterize protein samples using multiple biophysical techniques (native PAGE, mass spectrometry, circular dichroism)

  • Verify copper content using atomic absorption spectroscopy or ITC methods

  • Assess the oxidation state of the CuA center using EPR spectroscopy

  • Compare results across multiple expression and purification protocols

  • Implement standardized activity assays with well-defined conditions and controls

  • Consider the impact of detergent choice on protein stability and function

How can high-throughput approaches accelerate research on MT-CO2 variants from wild populations?

High-throughput approaches to studying MT-CO2 variants include:

  • Parallel expression and purification of multiple variants using automated systems

  • Microplate-based functional assays to compare electron transfer activities

  • Next-generation sequencing to rapidly identify variants across populations

  • Machine learning algorithms to correlate sequence variations with functional properties

  • Structural modeling based on homology to predict functional consequences of amino acid substitutions

These approaches are particularly valuable for studying natural populations of Apodemus sylvaticus, where large sample sizes and geographical distribution create challenges for traditional methods .

What are common pitfalls in recombinant expression of membrane-associated MT-CO2?

Common challenges and solutions include:

  • Low expression yields due to toxicity - address by using tightly regulated inducible systems or lower growth temperatures

  • Inclusion body formation - optimize solubilization using different detergents or consider refolding protocols

  • Lack of copper incorporation - supplement expression media with copper or include copper during protein purification

  • Protein instability - optimize buffer conditions with stabilizing agents and appropriate detergent concentrations

  • Heterogeneity in preparation - implement additional purification steps or optimize existing protocols

How can researchers distinguish between MT-CO2 functional variations due to sequence differences versus experimental artifacts?

To distinguish true functional variations from artifacts:

  • Standardize expression and purification protocols across all variants

  • Prepare multiple independent batches of each variant

  • Apply multiple functional assays that measure different aspects of activity

  • Verify protein stability under assay conditions using thermal shift assays or limited proteolysis

  • Include internal standards (e.g., well-characterized variants) in each experiment

  • Perform statistical analysis to assess significance of observed differences

What considerations are important when designing MT-CO2 constructs for specific research applications?

Construct design considerations include:

  • For structural studies: Consider truncated constructs removing transmembrane domains while preserving the CuA center

  • For functional studies: Maintain full-length protein with proper membrane integration

  • For interaction studies: Include appropriate tags positioned to avoid interference with binding interfaces

  • For evolutionary studies: Ensure constructs capture the full spectrum of natural variation

  • For expression optimization: Consider codon optimization based on the expression host

  • For all applications: Include proper controls including wild-type and site-directed mutants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.