Recombinant Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Apolipoprotein N-acyltransferase (Lnt) is a genetically engineered form of the bacterial enzyme responsible for catalyzing the final step in lipoprotein maturation. Found in Gram-negative bacteria such as Escherichia coli, Lnt transfers an acyl group from phosphatidylethanolamine (PE) to the α-amino group of the N-terminal cysteine in diacylated apolipoproteins, forming triacylated lipoproteins essential for membrane integrity, nutrient uptake, and virulence . Recombinant Lnt enables detailed biochemical and structural studies, offering insights into bacterial lipoprotein biosynthesis and potential therapeutic targeting .

Catalytic Mechanism

Lnt follows a two-step ping-pong mechanism:

  1. Acyl-Enzyme Intermediate Formation: The catalytic cysteine (C387) attacks the sn-1 acyl chain of PE, forming a thioester-linked palmitoyl intermediate .

  2. Acyl Transfer to Apolipoprotein: The α-amino group of the apolipoprotein’s N-terminal cysteine resolves the intermediate, producing triacylated lipoprotein .

Key Residues:

  • E267: Acts as a general base to activate C387 .

  • K335: Stabilizes tetrahedral intermediates during both steps .

Mutagenesis studies (e.g., C387A/S) confirm the essentiality of these residues for activity .

Enzyme Kinetics and Substrate Specificity

Recombinant Lnt exhibits distinct kinetic properties:

ParameterValue/ObservationSource
Acyl DonorPhosphatidylethanolamine (PE) preferred
MechanismPing-pong kinetics (slow acyl transfer, rapid resolution)
Substrate RecognitionBinds synthetic diacylglyceryl lipopeptides (e.g., FSL-1)
Phospholipid DependenceActivity varies with PE acyl chain length and headgroup

The Kₘ for PE is influenced by membrane composition, highlighting Lnt’s adaptability to lipid environments .

Escherichia coli

  • Lnt is essential for viability and virulence .

  • In vitro assays confirm Lnt’s ability to acylate apolipoproteins like murein lipoprotein (Lpp) .

Mycobacteria

  • Mycobacterial Lnt homologs triacylate lipoproteins using PE-derived C16 fatty acids, demonstrating conservation across Gram-positive Actinobacteria .

Neisseria meningitidis

  • Lnt disruption reduces surface expression of triacylated lipoproteins (e.g., factor H-binding protein), impairing immune recognition and vaccine efficacy .

Functional and Pathogenic Implications

  • Lipoprotein Sorting: Triacylation by Lnt directs lipoproteins to the outer membrane via the Lol transport system .

  • Virulence: Lnt-deficient E. coli and Neisseria strains show attenuated virulence in murine models .

  • Envelope Stress: Accumulation of diacylated lipoproteins in Lnt mutants triggers σᴱ-mediated stress responses, downregulating lipoprotein synthesis .

Applications and Therapeutic Potential

  • Antibiotic Development: Lnt’s essentiality and unique mechanism make it a target for novel Gram-negative antibiotics .

  • Vaccine Design: Understanding Lnt’s role in lipoprotein acylation aids in optimizing antigenic lipoproteins for vaccines .

  • Structural Biology: High-resolution Lnt structures guide inhibitor design to block acyl transfer without cross-reacting with human enzymes .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery information, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us. We will prioritize the development of the specified tag based on your request.
Synonyms
lnt; cutE; SF0625; S0647; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-512
Protein Length
full length protein
Species
Shigella flexneri
Target Names
lnt
Target Protein Sequence
MDFASLIERQRIRLLLALLFGACGTLAFSPYDVWPAAIISLMGLQALTFNRRPLQSAAIG FCWGFGLFGSGINWVYVSIATFGGMPGPVNIFLVVLLAAYLSLYTGLFAGVLSRLWPKTT WLRVAIATPALWQVTEFLRGWVLTGFPWLQFGYSQIDGPLKGLAPLMGVEAINFLLMMVS GLLALALVKRNWRPLVVAVVLFALPFPLRYIQWFTPQPEKTIQVSMVQGDIPQSLKWDEG QLLNTLKIYYNATAPLMGKSSLIIWPESAITDLEINQQPFLKALDGELRDKGSSLVTGIV DARLNKQNRYDTYNTIITLGKGAPYSYESADRYNKNHLVPFGEFVPLESILRPLAPFFDL PMSSFSRGPYIQPPLSANGIELTAAICYEIILAEQVRDNFRPDTDYLLTISNDAWFGKSI GPWQHFQMARMRALELARPLLRSTNNGITAVIGPQGEIQAMIPQFAREVLTTNVTPTTGL TPYARTGNWPLWVLTALFGFAAVLMSLRQRRK
Uniprot No.

Target Background

Function
Apolipoprotein N-acyltransferase (lnt) catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, representing the final step in lipoprotein maturation.
Database Links

KEGG: sfl:SF0625

Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase (Lnt) and what is its role in bacterial physiology?

Apolipoprotein N-acyltransferase (Lnt) is an integral membrane enzyme that catalyzes the third and final step in the post-translational modification pathway of bacterial lipoproteins. In Gram-negative bacteria like Escherichia coli, Lnt transfers an acyl chain from a phospholipid to the amine group of the N-terminal cysteine residue of apolipoproteins, resulting in the formation of mature triacylated lipoproteins . These lipoproteins are critical components of the bacterial cell envelope responsible for essential cellular functions including nutrient uptake, secretion, cell wall integrity, antibiotic production, and virulence in pathogenic bacteria .

The lipoprotein maturation process occurs in three sequential steps:

  • Diacylglyceryl (DAG) modification of pre-prolipoproteins by phosphatidylglycerol (PG):prolipoprotein DAG transferase (Lgt)

  • Cleavage of the signal peptide by prolipoprotein signal peptidase (Lsp)

  • N-acylation of the terminal cysteine by Lnt to form the mature triacylated lipoprotein

This process is particularly significant because it is unique to bacteria, with the N-acylation step being specific to Gram-negative bacteria, making Lnt a potential target for antimicrobial development.

What is the structural organization of Lnt?

Lnt's structure consists of two main domains with distinct functions:

  • Transmembrane Domain: Contains eight transmembrane (TM) helices that form a membrane-embedded cavity with a lateral opening and a periplasmic exit. This domain facilitates substrate access from the membrane environment .

  • Nitrilase Domain: Located on the periplasmic side of the membrane, this exo-membrane domain contains the catalytic cavity that connects to the periplasmic exit of the TM domain .

A key structural feature is the amphipathic lid loop extending from the nitrilase domain that interacts with the periplasmic lipid leaflet. This lid forms an interfacial entrance from the lipid bilayer to the catalytic center, allowing both lipid donor and acceptor substrates to access the active site .

The crystal structure of E. coli Lnt at 2.6 Å resolution reveals that these domains work together to facilitate the enzyme's function at the membrane-periplasm interface .

How does Lnt catalyze the N-acylation reaction?

Lnt operates via a ping-pong type mechanism involving two main steps:

  • Formation of Acyl-Enzyme Intermediate: Lnt first removes an acyl chain from a phospholipid donor (preferentially phosphatidylethanolamine in E. coli), forming a thioester acyl-enzyme intermediate via the catalytic cysteine in its active site .

  • N-Acyl Transfer: The acyl chain is subsequently transferred to the α-amino group of the N-terminal diacylglyceryl-modified cysteine of the apolipoprotein, creating the mature triacylated lipoprotein .

Kinetic studies have shown that the first step (acyl-enzyme intermediate formation) is relatively slow, while the second step (N-acyl transfer to the apolipoprotein) is rapid in vitro . The enzyme's catalytic mechanism involves conformational changes that control substrate access to the active site, with crystal structures showing both "open" and "closed" conformations .

What are the established methods for expressing and purifying recombinant Lnt?

Recombinant Lnt is typically expressed and purified using the following methodology:

  • Expression System: E. coli overexpression systems are commonly used with appropriate vector constructs containing the lnt gene with affinity tags (e.g., His-tag) for easier purification.

  • Membrane Protein Extraction: As an integral membrane protein, Lnt requires detergent solubilization from the cell membrane. Common detergents include n-dodecyl β-D-maltoside (DDM) or related detergents that maintain protein structure and function.

  • Purification Protocol:

    • Affinity chromatography (typically Ni-NTA for His-tagged constructs)

    • Size exclusion chromatography to achieve high purity

    • Ion exchange chromatography as needed for additional purification

  • Activity Verification: Purified enzyme activity is assessed through its ability to form the thioester acyl-enzyme intermediate and N-acylate substrate lipoproteins like the murein lipoprotein Lpp .

The purified enzyme must be maintained in an appropriate detergent-containing buffer system to preserve its native conformation and enzymatic activity.

What assays are available for measuring Lnt activity in vitro?

Several complementary approaches have been developed to assess Lnt activity:

Table 1: Common Assays for Measuring Lnt Activity

Assay TypeMethodologyDetection MethodAdvantagesLimitations
Radiolabeled Acyl TransferIncorporation of [³H]-palmitate into apolipoprotein substratesScintillation countingHigh sensitivity, quantitativeRequires radioactive materials
Mass SpectrometryMonitoring mass shift after N-acylationLC-MS/MSPrecise identification of modified productsExpensive equipment, complex analysis
Synthetic Lipopeptide AssayUsing synthetic substrates like FSL-1Various (MS, fluorescence)Well-defined substrate, controlled conditionsMay not fully reflect native substrate complexity
Acyl-Enzyme Intermediate FormationDetection of thioester acyl-enzyme intermediateSDS-PAGE, MSMonitors first catalytic stepDoesn't assess complete reaction

A particularly useful method involves a mixed micelle assay system using phospholipid acyl donors and synthetic diacylglyceryl-modified lipopeptide (FSL-1) as a substrate. This system has been used to determine the kinetic parameters of Lnt, demonstrating that the enzyme's activity is strongly affected by phospholipid headgroup and acyl chain composition .

What expression systems are optimal for structural studies of Lnt?

For structural studies, researchers commonly use the following expression strategies:

  • Bacterial Expression: E. coli remains the predominant system for Lnt expression, particularly for obtaining sufficient quantities for crystallization. C41(DE3) or C43(DE3) strains, designed for membrane protein expression, have been successfully used.

  • Construct Optimization:

    • Truncation constructs that maintain catalytic activity

    • Addition of fusion partners (e.g., T4 lysozyme) to enhance crystallization

    • Surface entropy reduction mutations to improve crystal packing

  • Stabilization Methods:

    • Addition of lipids during purification to maintain native environment

    • Use of lipidic cubic phase for crystallization

    • Nanodiscs or amphipols for cryo-EM studies

The crystal structures of E. coli Lnt have been solved by optimizing these conditions to capture different conformational states, including forms with the active site cysteine covalently modified with the thioester acyl-intermediate .

What conformational changes occur in Lnt during catalysis?

Crystallographic studies have revealed significant conformational dynamics in Lnt that are essential to its function:

  • Arm Movement: A highly dynamic arm domain (or lid loop) restricts access to the active site in one conformation while allowing substrate access in another. This conformational switch appears to be triggered by substrate binding .

  • Active Site Accessibility: Two distinct crystal forms show:

    • A "closed" conformation with the active site restricted by the dynamic arm and containing a covalent modification of the active site cysteine consistent with the thioester acyl-intermediate

    • An "open" conformation where the active site is exposed to the environment

  • Substrate-Induced Changes: Movement of essential loops and residues appears to be triggered by substrate binding, controlling the interaction between Lnt and the incoming apolipoprotein substrate .

These conformational changes provide a dynamic context for understanding how residues critical for Lnt function coordinate substrate binding, catalysis, and product release during the enzymatic reaction cycle.

How does phospholipid specificity affect Lnt activity?

Lnt exhibits pronounced specificity for both phospholipid headgroups and acyl chain composition:

This specificity contrasts with earlier observations and suggests that the lipid environment plays a crucial role in regulating Lnt function.

What is known about the substrate recognition mechanism of Lnt?

Lnt must recognize two distinct substrates: the phospholipid acyl donor and the apolipoprotein acceptor. Current understanding of substrate recognition includes:

  • Phospholipid Recognition:

    • The lateral opening in the transmembrane domain allows phospholipids to enter from the membrane environment

    • Specific residues within the transmembrane cavity interact with phospholipid headgroups

    • The acyl chains are positioned for nucleophilic attack by the catalytic cysteine

  • Apolipoprotein Recognition:

    • The diacylglyceryl group of the apolipoprotein appears to play a critical role in substrate specificity

    • The periplasmic exit of the transmembrane domain connects to the nitrilase domain's catalytic cavity, allowing apolipoprotein access to the active site

    • The N-terminal region of the apolipoprotein must be properly positioned for nucleophilic attack on the acyl-enzyme intermediate

  • Interface Access:

    • The amphipathic lid loop interacts with the periplasmic lipid leaflet, forming an interfacial entrance from the lipid bilayer to the catalytic center for both substrates

The dynamic conformational changes observed in crystal structures suggest that substrate binding triggers movements of essential loops and residues that control the interaction between Lnt and its substrates .

What are the major challenges in working with recombinant Lnt?

Researchers face several technical challenges when working with Lnt:

  • Membrane Protein Stability: As an integral membrane protein, Lnt is inherently difficult to maintain in a stable, active conformation outside its native membrane environment.

  • Detergent Sensitivity: The choice of detergent significantly impacts enzyme stability and activity, with some detergents preserving function while others may be inhibitory or destabilizing.

  • Enzymatic Assay Complexity: Developing reliable assays requires both lipid (phospholipid donor) and protein (apolipoprotein) substrates in a mixed micelle system, creating potential issues with substrate accessibility and assay reproducibility.

  • Structural Analysis Difficulties: Membrane proteins like Lnt present challenges for structural determination:

    • Crystallization can be difficult due to the presence of detergents

    • Dynamic regions (like the lid loop) introduce conformational heterogeneity

    • The membrane-embedded regions may not form favorable crystal contacts

Solutions include stabilizing mutations, lipid supplementation during purification, and capturing specific conformational states using substrate analogs or inhibitors.

How can researchers optimize conditions for Lnt crystallization?

Successful crystallization of Lnt has been achieved through several optimization strategies:

  • Detergent Screening: Systematic testing of various detergents and detergent concentrations to identify conditions that maintain protein stability while promoting crystal formation.

  • Lipid Supplementation: Addition of specific lipids during purification and crystallization to stabilize the protein in a native-like environment.

  • Crystallization Methods:

    • Vapor diffusion techniques (sitting or hanging drop)

    • Lipidic cubic phase crystallization, which provides a membrane-like environment

    • Bicelle crystallization systems

  • Additive Screening: Testing various small molecules, ions, and polymers that might promote crystal formation by affecting protein-protein interactions.

  • Construct Engineering:

    • Removal of flexible regions that might hinder crystallization

    • Introduction of surface mutations to promote crystal contacts

    • Fusion partners to provide additional crystal contact points

These approaches have led to the successful determination of E. coli Lnt crystal structures in different conformational states, providing valuable insights into the enzyme's mechanism .

How might Lnt be exploited as an antimicrobial target?

Lnt represents a promising antimicrobial target for several reasons:

  • Unique to Bacteria: The N-acylation step catalyzed by Lnt is specific to Gram-negative bacteria, offering potential selectivity for antibacterial agents .

  • Essential Function: Lipoproteins are crucial for bacterial viability and virulence, making their processing enzymes critical targets .

  • Structural Insights: The detailed structural information now available for Lnt provides a foundation for structure-based drug design .

Potential approaches for targeting Lnt include:

  • Competitive inhibitors that mimic the phospholipid donor or apolipoprotein acceptor

  • Mechanism-based inhibitors that form stable adducts with the catalytic cysteine

  • Allosteric inhibitors that lock the enzyme in inactive conformations

  • Compounds that disrupt the membrane association or proper folding of Lnt

The distinct conformational states observed in crystal structures provide multiple potential binding sites for inhibitor development, potentially offering new avenues for combating antimicrobial resistance.

What are the implications of Lnt conformational dynamics for enzyme mechanism studies?

The discovery of multiple conformational states in Lnt has significant implications for understanding enzyme mechanisms:

  • Substrate-Induced Conformational Changes: The observation that Lnt undergoes significant conformational changes between "open" and "closed" states suggests that substrate binding triggers specific molecular movements essential for catalysis.

  • Mechanistic Insights: The dynamic arm that restricts access to the active site provides a mechanism for controlling substrate access and product release during the catalytic cycle.

  • Structure-Function Relationships: The conformational states provide context for understanding how specific residues contribute to catalysis, explaining previous mutagenesis results and guiding future studies.

  • Methodology Development: These findings highlight the importance of capturing multiple states when studying enzymes, suggesting that traditional static structural approaches may miss critical aspects of enzyme function.

  • Broader Implications: The conformational dynamics observed in Lnt may represent a common theme among membrane-associated enzymes that must coordinate catalysis at the membrane-aqueous interface.

Future studies might employ techniques like hydrogen-deuterium exchange mass spectrometry, single-molecule FRET, or time-resolved crystallography to further elucidate the relationship between Lnt dynamics and catalysis.

How does Lnt vary across bacterial species?

Lnt shows interesting variations across bacterial species:

Table 2: Comparative Analysis of Lnt Across Bacterial Species

Bacterial GroupLnt PresenceStructural FeaturesFunctional DifferencesEvolutionary Significance
Gram-negativeUniversalEight TM helices, nitrilase domainComplete N-acylation of lipoproteinsEssential for OM sorting
Gram-positiveLimited distributionSimilar core structure when presentVariable requirement for functionSuggests specific adaptations
MycobacteriaPresentModified domain organizationMay have broader substrate specificityAdapted to unique cell envelope

While the core catalytic mechanism appears conserved, variations in:

  • Substrate specificity

  • Membrane topology

  • Regulatory mechanisms

  • Structural details of the substrate binding sites

These differences may reflect adaptations to different membrane compositions and environmental niches, potentially offering insights into bacterial evolution and adaptation.

How do the kinetics of Lnt compare to other acyltransferases?

Lnt exhibits distinctive kinetic properties compared to other acyltransferases:

  • Ping-Pong Mechanism: Lnt follows a ping-pong type mechanism with initial formation of an acyl-enzyme intermediate followed by transfer to the apolipoprotein substrate . This is similar to some other acyltransferases but with unique substrate specificity.

  • Rate-Limiting Step: In Lnt, the formation of the acyl-enzyme intermediate is slow, while the subsequent transfer to the apolipoprotein is rapid . This differs from some related enzymes where product release may be rate-limiting.

  • Substrate Specificity: Unlike many acyltransferases with broad substrate ranges, Lnt shows pronounced specificity for both phospholipid donor and apolipoprotein acceptor substrates . The enzyme's activity is strongly affected by phospholipid headgroup and acyl chain composition.

  • Membrane Association: As an integral membrane protein, Lnt's kinetics are influenced by the membrane environment, distinguishing it from soluble acyltransferases that operate in aqueous environments.

Understanding these kinetic distinctions provides insight into how Lnt has evolved to perform its specialized function in bacterial lipoprotein processing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.