Recombinant Apteryx australis Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Apteryx australis (Southern brown kiwi)
Target Names
Target Protein Sequence
AICSLVLYLLTLMLMEKLSSNSVDAQEVELVWTILPAIVLILLALPSLQILYMMDEIDEP DLTLKAIGHQWYWTYEYTDFKDLSFDSYMIPTSELPLGHFRLLEVDHRVVVPMESPIRVI ITAGDVLHSWAVPTLGVKTDAIPGRLNQTSFITTRPGIFYGQCSEICGANHSYMPIVVES TPLPHFENWSSLLSTSSSL
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes collaboratively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the CuA center of subunit 2 and heme A of subunit 1 to the binuclear center (heme a3 and CuB) in subunit 1. This binuclear center reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Apteryx australis Cytochrome c oxidase subunit 2 (MT-CO2) and what is its function in cellular metabolism?

    Cytochrome c oxidase subunit 2 (MT-CO2) is a mitochondrially-encoded protein that forms a critical component of Complex IV in the electron transport chain. In Apteryx australis (Brown kiwi), as in other species, this protein is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase, a crucial step in the production of ATP during cellular respiration . The protein contains highly conserved regions that facilitate electron transport while also exhibiting species-specific variations, particularly in regions that interact with nuclear-encoded subunits .

  • What are the optimal storage conditions for recombinant Apteryx australis MT-CO2?

    For optimal preservation of recombinant Apteryx australis MT-CO2, store the protein at -20°C, or at -80°C for extended storage. The protein is typically provided in a Tris-based buffer with 50% glycerol, optimized for stability . Repeated freeze-thaw cycles should be avoided as they can lead to protein degradation and loss of functional activity. For working aliquots, storage at 4°C is recommended for up to one week . When reconstituting lyophilized protein, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, and consider adding glycerol (5-50% final concentration) for long-term storage.

  • How can PCR amplification be optimized for MT-CO2 from Apteryx species?

    Optimizing PCR amplification of MT-CO2 from Apteryx species requires careful consideration of several parameters:

    • Use specific primers designed for the conserved regions flanking the MT-CO2 gene, typically yielding amplicons of approximately 700 bp

    • Extract high-quality genomic DNA using specialized protocols for avian samples

    • Implement a touchdown PCR protocol starting with an initial denaturation at 94°C for 5 minutes, followed by 35-40 cycles of:

      • Denaturation at 94°C for 30 seconds

      • Annealing at 55-58°C for 30 seconds (optimize for specific primers)

      • Extension at 72°C for 45 seconds

      • Final extension at 72°C for 10 minutes

    To verify successful amplification, analyze PCR products on a 1.5% agarose gel with appropriate molecular weight markers .

Advanced Research Questions

  • What methodologies are recommended for expressing recombinant Apteryx australis MT-CO2 in heterologous systems?

    Expression of recombinant Apteryx australis MT-CO2 in heterologous systems requires specialized approaches due to its mitochondrial origin. A recommended methodology involves:

    1. Vector design: Engineer an expression vector containing the codon-optimized MT-CO2 sequence with an N-terminal His-tag for purification. Ensure the vector contains appropriate regulatory elements for the chosen expression system .

    2. Expression system selection: While E. coli is commonly used for recombinant protein expression, the mitochondrial nature of MT-CO2 presents challenges. For functional studies, consider using:

      • E. coli with the System I (CcmABCDEFGH) bacterial cytochrome c biogenesis pathway

      • Insect cells (Sf9 or Hi5) with baculovirus expression systems

      • Yeast systems with mitochondrial targeting sequences

    3. Optimization protocol:

      • For E. coli expression: Induce at OD600 0.6-0.8 with 0.5 mM IPTG at 18°C for 16-20 hours to minimize inclusion body formation

      • Include 5-aminolevulinic acid (50 μg/mL) and ferric citrate (100 μM) in the medium to support heme synthesis

      • Use specialized lysis buffers containing 1% mild detergent (e.g., n-dodecyl-β-D-maltoside) to solubilize the membrane-associated protein

    4. Purification strategy: Implement a two-step purification process using immobilized metal affinity chromatography followed by size exclusion chromatography in the presence of suitable detergents to maintain protein stability .

  • How does the evolutionary rate of MT-CO2 in Apteryx australis compare with other avian and non-avian species?

    Evolutionary rate analysis of MT-CO2 reveals interesting patterns in Apteryx australis compared to other species:

    Comparative analysis shows that while primate lineages have undergone a nearly two-fold increase in the rate of amino acid replacement relative to other mammals , Apteryx species exhibit a more conservative rate of evolution despite their ecological specialization. This evolutionary pattern is characterized by:

    1. Strong purifying selection (ω << 1) across the majority of codons in the MT-CO2 gene

    2. Significantly lower interpopulation genetic divergence compared to some other species like Tigriopus californicus, which shows up to 20% divergence at the nucleotide level between populations

    3. A distinct pattern of evolution in the amino terminal end of the protein, which shows greater variation compared to the functionally critical core regions

    The evolutionary conservation of MT-CO2 in kiwi likely reflects the crucial role this protein plays in cellular respiration and the strong selective pressure to maintain its function .

  • What analytical techniques are most effective for assessing the functional activity of recombinant Apteryx australis MT-CO2?

    Several analytical techniques can effectively assess the functional activity of recombinant Apteryx australis MT-CO2:

    1. In-gel activity assays: This technique allows visualization of cytochrome c oxidase activity directly in native gels. The method involves:

      • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE) separation

      • In-gel activity staining using 3,3'-diaminobenzidine and cytochrome c as substrates

      • Quantification using densitometry

    2. Polarographic oxygen consumption assays: Using a Clark-type oxygen electrode to measure oxygen consumption rates when the purified protein is incorporated into liposomes or proteoliposomes.

    3. Spectrophotometric analysis: Monitoring the oxidation of reduced cytochrome c at 550 nm to assess electron transfer efficiency.

    4. Surface plasmon resonance (SPR): For analyzing the binding kinetics between MT-CO2 and cytochrome c or other components of the respiratory chain.

    When conducting these assays, it's critical to normalize the data against appropriate standards. For instance, in-gel activity analysis results can be normalized by the level of complex III to provide accurate quantification of cytochrome c oxidase levels .

  • How can researchers analyze the interaction between recombinant Apteryx australis MT-CO2 and nuclear-encoded subunits of cytochrome c oxidase?

    Analyzing the interaction between recombinant Apteryx australis MT-CO2 and nuclear-encoded subunits requires specialized approaches:

    1. Co-immunoprecipitation (Co-IP): Using antibodies against MT-CO2 or against specific nuclear-encoded subunits to pull down protein complexes, followed by SDS-PAGE and Western blotting to identify interacting partners.

    2. Bioluminescence Resonance Energy Transfer (BRET): By tagging MT-CO2 with a luciferase donor and nuclear-encoded subunits with fluorescent acceptor proteins to detect protein-protein interactions in living cells.

    3. Crosslinking mass spectrometry: Applying chemical crosslinkers followed by mass spectrometric analysis to identify interaction sites between MT-CO2 and other subunits.

    4. Blue Native PAGE combined with second-dimension SDS-PAGE: This approach allows separation of intact complexes followed by identification of individual subunits.

    5. Threshold analysis: Research indicates that approximately 40% of the normal level of functional cytochrome c oxidase subunit IV (COX IV) protein might be adequate to maintain normal levels of cytochrome c oxidase assembly . Similar threshold analyses can be performed for MT-CO2 to determine its stoichiometric requirements for proper complex assembly.

  • What are the best approaches for conducting site-directed mutagenesis studies on Apteryx australis MT-CO2?

    Site-directed mutagenesis studies on Apteryx australis MT-CO2 should follow these methodological approaches:

    1. Target identification: Focus mutations on:

      • Regions involved in electron transfer (highly conserved domains)

      • Species-specific amino acid variations that may be involved in adaptation

      • Key residues at the interface with nuclear-encoded subunits

    2. Mutagenesis protocols:

      • QuikChange site-directed mutagenesis for single amino acid substitutions

      • Gibson Assembly or overlap extension PCR for introducing multiple mutations

      • CRISPR-Cas9 approaches for studying mutations in cellular contexts

    3. Functional assessment strategy:

      • Express wild-type and mutant proteins in parallel

      • Compare electron transfer efficiency using spectrophotometric assays

      • Assess complex assembly via BN-PAGE

      • Evaluate changes in protein-protein interactions using Co-IP or SPR

    4. Structural analysis:

      • Use homology modeling based on available cytochrome c oxidase structures

      • Perform molecular dynamics simulations to predict the impact of mutations on protein dynamics and function

    Of particular interest would be mutations in the amino terminal end of the protein, which has been shown to exhibit greater variability across species and may be involved in species-specific adaptations .

  • How can researchers investigate the potential role of MT-CO2 sequence variations in kiwi adaptation to their unique ecological niche?

    Investigating MT-CO2 sequence variations in kiwi adaptation requires a multifaceted approach:

    1. Comparative genomic analysis:

      • Sequence MT-CO2 from multiple kiwi populations and all five kiwi species (Apteryx australis, A. mantelli, A. rowi, A. owenii, and A. haastii)

      • Compare with MT-CO2 sequences from other ratites (ostrich, emu) and flying birds

      • Identify kiwi-specific substitutions using phylogenetic methods

    2. Selection pressure analysis:

      • Calculate the ratio of nonsynonymous to synonymous substitutions (ω) using maximum likelihood models of codon substitution

      • Identify sites under positive selection (ω > 1) versus purifying selection (ω < 1)

      • Employ branch-site models to detect selection specific to the kiwi lineage

    3. Functional consequences assessment:

      • Express recombinant MT-CO2 variants and assess their functional properties at different temperatures

      • Measure enzymatic efficiency under varying oxygen concentrations to test adaptation to the kiwi's nocturnal, ground-dwelling lifestyle

      • Analyze the interaction efficiency between kiwi MT-CO2 and cytochrome c compared to other avian species

    4. Integration with ecological data:

      • Correlate MT-CO2 variations with ecological parameters such as altitude, temperature range, and activity patterns

      • Examine whether MT-CO2 variations correlate with metabolic differences between kiwi populations

    This approach can provide insights into how MT-CO2 may have adapted to support the unique metabolic requirements of kiwi as flightless, nocturnal, ground-dwelling birds with exceptionally low metabolic rates compared to other avian species .

  • What methods can be employed to study the assembly of MT-CO2 into functional cytochrome c oxidase complexes?

    Studying the assembly of MT-CO2 into functional cytochrome c oxidase complexes can be approached through several methods:

    1. Pulse-chase labeling: Use radioactive amino acids to label newly synthesized proteins, followed by immunoprecipitation at different time points to track the incorporation of MT-CO2 into assembling complexes.

    2. Import assays: Isolate mitochondria and perform in vitro import assays with recombinant MT-CO2 to study the kinetics and requirements for incorporation into the complex.

    3. Proximity labeling techniques: Employ BioID or APEX2 fusion proteins to identify proteins in close proximity to MT-CO2 during the assembly process.

    4. Quantitative proteomics: Use SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tag) labeling to quantify changes in the stoichiometry of complex components during assembly.

    5. Blue Native PAGE analysis: This technique has revealed that cytochrome c oxidase levels can be assessed through:

      • In-gel activity assays showing enzyme functionality

      • Immunoblot analysis with antibodies against specific subunits

      • Quantification relative to other mitochondrial complexes like complex III

    Research has demonstrated that when COX IV (another subunit) levels increase from 6% to 14% of normal levels, cytochrome c oxidase activity increases linearly, indicating a threshold effect in complex assembly . Similar analyses can determine whether MT-CO2 exhibits such threshold-dependent assembly characteristics.

Specialized Technical Questions

  • What are the recommended approaches for extracting and purifying mitochondria from Apteryx tissue samples for subsequent MT-CO2 analysis?

    Extracting and purifying mitochondria from Apteryx tissue samples requires careful handling of this protected species' material:

    1. Sample collection:

      • Blood samples (≤1 mL) can be collected in EDTA or heparin as anticoagulants

      • Feather samples may also yield viable mtDNA for genetic studies

      • All collection requires appropriate permits from conservation authorities

    2. Mitochondrial extraction protocol:

      • Resuspend blood cells in hypotonic buffer (10mM NaCl, 1.5mM MgCl₂, 10mM Tris-HCl, pH 7.5)

      • Allow cells to swell at 4°C for 10 minutes

      • Disrupt cells with a homogenizer in short 1-second bursts to achieve 60-70% cell breakage

      • Add 2.5× MSB buffer (0.525M D-mannitol, 175mM sucrose, 12.5mM EDTA, 12.5mM Tris-HCl, pH 7.5) to a final concentration of 1× MSB

      • Centrifuge at 1,000 × g for 10 minutes to remove cell debris and nuclear fractions

    3. Mitochondrial purification:

      • Further purify the mitochondrial fraction by gradient centrifugation

      • Verify mitochondrial integrity using oxygen consumption assays or membrane potential measurements

    4. Mitochondrial DNA extraction:

      • For genetic studies, extract mtDNA using specialized kits for circular DNA

      • Alternatively, amplify MT-CO2 directly from total DNA using specific primers

    This methodology has been successfully applied to kiwi samples and can yield intact mitochondria suitable for functional studies or genetic analysis .

  • How does the expression of MT-CO2 vary across different tissues in Apteryx australis, and what techniques are recommended for tissue-specific expression analysis?

    Analyzing tissue-specific expression of MT-CO2 in Apteryx australis requires specialized approaches:

    1. Tissue collection and preservation:

      • Samples should be collected from ethically sourced materials (e.g., deceased specimens from conservation programs)

      • Flash-freeze tissues in liquid nitrogen immediately after collection

      • Store at -80°C or preserve in RNAlater for RNA-based studies

    2. Expression analysis techniques:

      • RT-qPCR: Design primers specific to kiwi MT-CO2 and appropriate reference genes

      • RNA-Seq: Perform transcriptome sequencing across multiple tissues

      • In situ hybridization: Use MT-CO2-specific probes to visualize expression patterns in tissue sections

      • Immunohistochemistry: Employ antibodies against MT-CO2 for protein localization

    3. Data normalization strategies:

      • Normalize MT-CO2 expression against mitochondrial content (using markers like citrate synthase)

      • Use multiple reference genes for accurate RT-qPCR normalization

      • Account for tissue-specific mitochondrial density variations

    4. Comparative analysis:

      • Compare expression patterns with other ratites and flying birds

      • Correlate expression levels with tissue-specific metabolic demands

    Studies of kiwi transcriptomes have revealed patterns of gene expression that reflect their unique evolutionary history, with MT-CO2 expression potentially varying among tissues in correlation with their metabolic activity and mitochondrial content .

  • What bioinformatic pipelines are most appropriate for analyzing MT-CO2 sequence data from Apteryx species in phylogenetic studies?

    For phylogenetic analysis of MT-CO2 sequence data from Apteryx species, the following bioinformatic pipeline is recommended:

    1. Sequence quality control and preprocessing:

      • Trim low-quality bases (Q<20) and adapter sequences using Trimmomatic or similar tools

      • Assess sequence quality using FastQC

      • Perform error correction if necessary

    2. Sequence alignment:

      • Use MAFFT or MUSCLE for initial alignment of MT-CO2 sequences

      • Refine alignments manually to ensure codon integrity

      • Consider using codon-aware alignment tools like MACSE for protein-coding genes

    3. Model selection:

      • Determine the best-fit nucleotide or codon substitution model using ModelTest-NG or similar tools

      • For protein sequences, use ProtTest to identify the optimal amino acid substitution model

    4. Phylogenetic reconstruction:

      • Maximum Likelihood: RAxML-NG or IQ-TREE with bootstrapping (1000 replicates)

      • Bayesian Inference: MrBayes or BEAST2 for time-calibrated phylogenies

      • Consider partitioning by codon position or using codon models

    5. Selection analysis:

      • Use PAML's codeml to estimate the ratio of nonsynonymous to synonymous substitutions (ω)

      • Apply branch-site models to detect lineage-specific selection

      • Employ FUBAR or MEME from the HyPhy package to identify sites under selection

    6. Visualization and interpretation:

      • Visualize trees with FigTree or iTOL

      • Map amino acid substitutions onto the phylogeny

      • Compare with other mitochondrial and nuclear genes to identify discordance

    This approach has been successfully applied to studies of kiwi phylogenetics, revealing patterns of genetic divergence that inform conservation strategies for these endangered birds .

  • What challenges and solutions exist for expressing and purifying functional Apteryx australis MT-CO2 for structural studies?

    Expressing and purifying functional Apteryx australis MT-CO2 for structural studies presents several challenges:

    1. Expression challenges and solutions:

      ChallengeSolution
      Mitochondrial origin with different codon usageUse codon-optimized synthetic genes adapted for the expression system
      Membrane protein solubilityExpress with fusion partners (MBP, SUMO, etc.) to enhance solubility
      Proper foldingCo-express with chaperones (GroEL/ES) in E. coli systems
      Heme incorporationUse E. coli strains with the System I (CcmABCDEFGH) cytochrome c biogenesis pathway
      Low expression yieldsOptimize induction conditions (temperature, inducer concentration, time)
    2. Purification challenges and solutions:

      ChallengeSolution
      Membrane protein extractionUse appropriate detergents (DDM, LMNG) or amphipols for solubilization
      Maintaining protein stabilityInclude glycerol (20-50%) in all buffers
      Protein heterogeneityEmploy size exclusion chromatography as a final purification step
      Heme retentionInclude protease inhibitors and reducing agents in all buffers
      Aggregation during concentrationUse sucrose gradient ultracentrifugation instead of filtration-based concentration
    3. Structural study considerations:

      • For X-ray crystallography: Screen multiple detergents and lipids to identify conditions promoting crystal formation

      • For Cryo-EM: Consider incorporating MT-CO2 into nanodiscs or amphipols

      • For NMR studies: Produce isotopically labeled protein in minimal media supplemented with 15N-labeled amino acids

    4. Functional validation:

      • Confirm heme incorporation via UV-Vis spectroscopy

      • Verify electron transfer capability using reduced cytochrome c as a substrate

      • Assess complex formation with other cytochrome c oxidase subunits

    These approaches address the specific challenges of working with this membrane-associated mitochondrial protein while maximizing the likelihood of obtaining functionally relevant structural data.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.