Recombinant Aquareovirus C Non-structural protein 5 (S7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
S7; Non-structural protein 5; NS5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Aquareovirus C (isolate Golden shiner/USA/GSRV/1977) (AQRV-C)
Target Names
S7
Target Protein Sequence
MPCQDTVSLSIQHTSVYVQHSCCVSTSTSASTSATALGLGCLACGIVGVLVVAGGLCCLI NGRCPSCRRLALRSRSWKSPPASLCTNQPLAFNLRDLTRSDIRCTSDPRSVELLSDVHSV VSHRERPPAYDSLDFEPTEYTPEAFQ
Uniprot No.

Target Background

Database Links

KEGG: vg:2648335

Protein Families
Aquareoviridae NS5 protein family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the S7 genome segment in aquareoviruses and what does it encode?

The S7 genome segment of aquareoviruses is a polycistronic segment that encodes multiple proteins, most notably the fusion-associated small transmembrane (FAST) proteins responsible for syncytiogenesis. In Atlantic salmon reovirus (AtSRV), the S7 segment uses a noncanonical CUG translation start codon to produce a 22-kDa integral membrane protein (p22) that mediates cell-cell fusion. This protein represents a distinct member of the FAST protein family with unique structural motifs . Different aquareovirus species may have variations in their S7-encoded proteins - for example, some encode an NS22 protein (as in marine aquareoviruses), while others produce an NS16 protein (as in freshwater aquareoviruses) .

What are FAST proteins and how do they function in aquareoviruses?

FAST proteins are small, nonstructural viral proteins unique to fusogenic reoviruses that mediate cell-cell fusion and syncytium formation. They are the only known examples of membrane fusion proteins encoded by nonenveloped viruses . These proteins have membrane-destabilizing activity that promotes the formation of multinucleated syncytia in infected cells. The FAST protein family includes different members with distinct structures but similar functions, such as the p22 protein in Atlantic salmon reovirus and the NS22 protein in MsReV . They are believed to contribute to viral pathogenicity by enhancing localized and systemic dissemination of infection through syncytium formation .

What are the recommended methods for cloning and expressing the S7 segment proteins?

For cloning and expressing S7 segment proteins, researchers should consider the following methodological approach:

  • RNA extraction and cDNA synthesis: Extract viral RNA from infected cells and synthesize cDNA using reverse transcription.

  • PCR amplification: Design primers targeting the S7 segment, considering potential noncanonical start codons (e.g., CUG instead of AUG) .

  • Cloning strategy:

    • For FAST proteins like NS22, amplify different regions of S7 including full-length coding sequences and various deletions or mutations

    • Ligate PCR products into appropriate expression vectors (e.g., pcDNA3.1(+) for mammalian expression)

    • Consider fusion constructs with reporter proteins like EGFP (e.g., pEGFP-NS22)

  • Transfection and expression: Use lipid-based transfection reagents like Lipofectamine 2000 for introducing constructs into susceptible cell lines such as Vero, quail, or fish cell lines (e.g., GCF cells) .

  • Verification: Confirm expression through syncytium formation assays, immunofluorescence, or Western blotting depending on the specific research question .

The choice of expression system should be carefully considered based on the specific research questions and downstream applications.

How can researchers detect and analyze syncytium formation induced by recombinant FAST proteins?

To detect and analyze syncytium formation induced by recombinant FAST proteins, researchers should implement the following methodological procedures:

  • Cell culture preparation: Grow susceptible cells (such as Vero, quail, or fish cell lines like GCF) in appropriate medium in multi-well plates (typically 24-well plates).

  • Transfection: Transfect cells with plasmids expressing FAST proteins using a suitable transfection reagent like Lipofectamine 2000 following manufacturer's protocols.

  • Fixation and staining:

    • For light microscopy: At 48 hours post-transfection, fix cells with methanol and stain with Wright-Giemsa staining to visualize multinucleated syncytia .

    • For fluorescence microscopy: If using GFP-tagged constructs (e.g., pEGFP-NS22), fix cells with 4% paraformaldehyde and counterstain nuclei with Hoechst 33342 .

  • Quantification methods:

    • Count the number of nuclei per syncytium

    • Measure the syncytium area

    • Calculate fusion index (ratio of nuclei in syncytia to total nuclei)

  • Controls: Include appropriate controls such as point mutations disrupting the start codon (e.g., changing CUG to CCG) or deletion mutants to confirm specificity of the fusion activity.

This comprehensive approach allows for reliable detection and quantitative analysis of FAST protein-induced syncytium formation.

How can the NSP5-based platform be used to study protein-protein interactions in aquareovirus?

The NSP5-based platform provides a valuable tool for studying protein-protein interactions in aquareoviruses, particularly for identifying regions of viral proteins required for associations with other viral components. The methodology involves:

  • Platform principle: The system uses the ability of NSP5 to form viral factories in transfected cells as a fusion protein to detect protein-protein interactions. When two proteins interact, they colocalize in distinctive globular structures .

  • Experimental procedure:

    • Create fusion constructs where one protein (bait) is fused to GFP-NSP5

    • Co-express this fusion protein with another viral protein of interest (prey)

    • Analyze colocalization using fluorescence microscopy

    • Non-interacting proteins will form separate distinctive globular structures

    • Interacting proteins will show complete colocalization of their respective structures

  • Controls: Include appropriate controls to rule out that viral inclusion bodies are caused by protein misfolding or non-specific aggregation (e.g., test colocalization with poly-ubiquitination or vimentin) .

  • Applications: This platform can be used to:

    • Map interaction domains between viral proteins

    • Study the role of specific amino acid residues in protein-protein associations

    • Investigate the dynamics of viral inclusion body formation

This method provides a reliable approach to visualize and analyze protein-protein interactions in living cells without the limitations of biochemical methods that might disrupt weak or transient interactions .

What are the structural determinants of FAST protein function in aquareoviruses?

The structural determinants of FAST protein function in aquareoviruses involve a complex arrangement of domains and motifs that work cooperatively to mediate membrane fusion. Based on current research:

  • Start codon significance: The NS22 protein of MsReV and other aquareoviruses is translated from a noncanonical CUG start codon, and this feature is critical for protein function. Mutation of this codon (e.g., CUG to CCG) prevents synthesis of the protein and abolishes syncytium formation .

  • N-terminal region importance: Deletion analysis has shown that the N-terminal region of NS22 is essential for its fusion activity. Studies with MsReV demonstrated that deletion constructs like 14-613 retained fusion activity, but further deletions (15-613, 17-613) eliminated the protein's ability to induce syncytium formation .

  • Transmembrane domain: As the name suggests (fusion-associated small transmembrane), these proteins contain at least one transmembrane domain essential for membrane insertion and fusion function.

  • Species-specific variations: FAST proteins from different aquareovirus species show notable structural differences that may correlate with host environments. Aquareoviruses from hosts in saline environments (like MsReV and SMReV) encode an NS22 protein, while those from freshwater hosts (like AGCRV, GSRV, and GCRV-873) encode a smaller NS16 protein .

The table below summarizes key structural features and their functional significance:

Structural FeatureFunctionEffect of Mutation/Deletion
CUG start codonInitiates translation of NS22Mutation to CCG abolishes protein expression and fusion activity
N-terminal regionCritical for fusion functionDeletions beyond position 14 eliminate fusion activity
Transmembrane domainMembrane insertion and anchoringDisruption prevents membrane fusion
C-terminal regionMay regulate fusion efficiencyVaries by aquareovirus species

Understanding these structural determinants provides insights into the evolution and function of these unique viral fusion proteins .

How does host environment influence aquareovirus genomic diversity, particularly in the S7 segment?

Host environment appears to play a crucial role in shaping aquareovirus genomic diversity, with particular impact on the S7 segment. The research findings suggest:

  • Environmental correlation: Aquareoviruses isolated from hosts in similar environments (e.g., saline water) show marked genomic similarities, even when isolated from different locations and times. Conversely, viruses from hosts in different environments (e.g., freshwater versus marine) show greater genomic divergence .

  • FAST protein divergence: The structure of FAST proteins encoded by the S7 segment correlates strongly with host environment. Aquareoviruses from marine hosts typically encode an NS22 protein, while those from freshwater hosts encode an NS16 protein or may lack the corresponding gene entirely (as in GCReV-109) .

  • Evolutionary mechanisms: Several factors may contribute to this environment-associated genetic variation:

    • Mutations during viral replication

    • Recombination between related viral strains

    • Genome segment reassortment between different viral isolates

  • Functional adaptation: These genomic differences likely reflect adaptation to specific host physiological conditions, potentially affecting viral replication efficiency, transmission dynamics, and pathogenicity in different aquatic environments .

This relationship between host environment and viral genomic structure provides a unique opportunity to study the evolutionary mechanisms of multisegmented RNA viruses and their adaptation to different ecological niches .

What methodological approaches can be used to study the role of FAST proteins in viral pathogenesis?

Several sophisticated methodological approaches can be employed to investigate the role of FAST proteins in viral pathogenesis:

  • Reverse genetics systems:

    • Generate recombinant viruses with mutations or deletions in the FAST protein gene

    • Create chimeric viruses by swapping FAST proteins between different aquareovirus strains

    • Analyze the effects on viral replication, cell-to-cell spread, and pathogenicity

  • In vivo infection models:

    • Develop appropriate fish infection models (e.g., Atlantic salmon for AtSRV)

    • Compare the pathogenicity of wild-type viruses with FAST protein mutants

    • Analyze tissue tropism, viral loads, and histopathological changes

  • Cell-based assays:

    • Develop quantitative syncytium formation assays to measure FAST protein activity

    • Use live-cell imaging to monitor the dynamics of cell-cell fusion in real-time

    • Investigate the effects of fusion activity on viral spread in polarized cell cultures

  • Molecular interaction studies:

    • Employ the NSP5-based platform to identify viral or cellular proteins that interact with FAST proteins

    • Use mutagenesis to map functional domains and interaction surfaces

    • Investigate potential cellular receptors or fusion regulators

  • Structural biology approaches:

    • Determine the three-dimensional structure of FAST proteins using X-ray crystallography or cryo-electron microscopy

    • Study conformational changes during the fusion process using biophysical techniques

These approaches, used in combination, would provide comprehensive insights into how FAST proteins contribute to viral dissemination and pathogenesis in infected hosts .

How do aquareovirus FAST proteins compare with other viral fusion proteins?

Aquareovirus FAST proteins represent a unique class of viral fusion proteins that differ fundamentally from those found in other viruses:

  • Structural comparison:

    • FAST proteins are remarkably small (22 kDa for p22/NS22) compared to typical viral fusion proteins (40-90 kDa)

    • They lack the large ectodomains characteristic of enveloped virus fusion proteins

    • They are nonstructural proteins, unlike the structural fusion proteins of most other viruses

  • Mechanistic differences:

    • FAST proteins are the only known fusion proteins encoded by nonenveloped viruses

    • They mediate cell-cell fusion rather than virus-cell fusion

    • They function primarily in viral spread rather than entry

  • Evolutionary considerations:

    • FAST proteins represent a novel solution to the challenge of viral spread

    • Their presence correlates with enhanced pathogenicity compared to non-fusogenic reovirus species

    • They may have evolved independently to facilitate localized and systemic dissemination of infection

  • Functional consequences:

    • Unlike fusion proteins of enveloped viruses that are essential for infection, FAST proteins are accessory proteins that enhance viral spread

    • Their activity in forming syncytia appears to contribute to pathogenicity by facilitating cell-to-cell transmission

This distinct nature of FAST proteins highlights their value as models for understanding novel mechanisms of membrane fusion and as potential targets for antiviral strategies .

What is the evolutionary relationship between different aquareovirus FAST proteins?

The evolutionary relationships between different aquareovirus FAST proteins reveal intriguing patterns that correlate with host environments and viral phylogeny:

  • Phylogenetic grouping:

    • FAST proteins cluster into distinct subgroups that correlate with host environments

    • NS22 proteins from viruses infecting hosts in saline environments (MsReV, SMReV) form one subgroup

    • NS16 proteins from viruses infecting freshwater hosts (AGCRV, GSRV, GCRV-873) form another subgroup

    • Some freshwater aquareoviruses (like GCReV-109) lack corresponding FAST protein genes

  • Structural conservation and divergence:

    • The p22/NS22 protein of Atlantic salmon reovirus represents a fourth distinct member of the FAST protein family

    • It shares functional properties with other FAST proteins but has a unique repertoire and arrangement of structural motifs

    • The use of noncanonical CUG start codons appears to be conserved across various aquareovirus FAST proteins

  • Host adaptation signatures:

    • The divergence in FAST protein structure correlates more strongly with host physiological environment than with geographical distribution

    • This suggests adaptive evolution in response to specific host conditions rather than simple geographic isolation

  • Implications for viral taxonomy:

    • FAST protein diversity provides additional markers for aquareovirus classification

    • The correlation between FAST protein structure and host environment offers insights into viral adaptation mechanisms

These evolutionary relationships indicate that FAST proteins have undergone significant adaptation during aquareovirus evolution, potentially reflecting specialization to different host environments .

How can genomic diversity of aquareoviruses inform vaccine development strategies?

Understanding the genomic diversity of aquareoviruses, particularly in the S7 segment and FAST proteins, has important implications for vaccine development strategies in aquaculture:

  • Antigen selection considerations:

    • The environment-associated genomic variation suggests that vaccines should be tailored to specific aquatic environments

    • Viruses from similar environments (e.g., all marine or all freshwater) may share conserved epitopes that could be targeted by broadly protective vaccines

    • FAST proteins, due to their role in pathogenicity, might represent potential vaccine targets, but their diversity must be considered

  • Cross-protection challenges:

    • The significant genomic differences between aquareoviruses from different host environments may limit cross-protection

    • Vaccine development may need to focus on conserved regions of the viral genome or incorporate antigens from multiple strains

  • Surveillance and monitoring implications:

    • Understanding the correlation between genomic structure and host environment can inform surveillance programs

    • This knowledge helps predict which viral variants might emerge in specific aquaculture settings

  • Reverse vaccinology approach:

    • Comparative genomic analysis can identify conserved protein domains across different aquareovirus strains

    • These conserved regions can be prioritized as vaccine candidates

    • Structural analysis of FAST proteins can reveal potential neutralizing epitopes

  • Adaptation monitoring:

    • The known association between viral genomic structure and host environment provides a framework for monitoring viral adaptation

    • This can help anticipate vaccine escape mutants and inform vaccine update strategies

By leveraging knowledge of aquareovirus genomic diversity, researchers can develop more effective vaccines tailored to specific aquaculture environments and viral strains, potentially reducing economic losses in the industry .

What are common challenges in expressing and purifying recombinant aquareovirus S7 proteins?

Researchers working with recombinant aquareovirus S7 proteins often encounter several technical challenges that require specific optimization approaches:

  • Noncanonical start codon recognition:

    • Challenge: The CUG start codon used by many aquareovirus FAST proteins may not be efficiently recognized in heterologous expression systems .

    • Solution: Consider modifying the start codon to AUG for higher expression, but validate that this doesn't alter protein function. Alternatively, use expression systems with high fidelity for alternative start codon recognition.

  • Protein toxicity issues:

    • Challenge: The membrane-destabilizing activity of FAST proteins can be toxic to host cells during expression.

    • Solution: Use inducible expression systems to control expression timing and level. Consider using fusion tags that might reduce toxicity until purification.

  • Solubility limitations:

    • Challenge: As integral membrane proteins, FAST proteins are inherently difficult to solubilize while maintaining structural integrity.

    • Solution: Optimize detergent screening (try mild detergents like DDM, LMNG, or digitonin). Consider expressing functional domains separately if studying specific interactions.

  • Purification complexity:

    • Challenge: Membrane proteins often aggregate during purification steps.

    • Solution: Use size exclusion chromatography to separate aggregates. Consider amphipol or nanodisc technologies for stabilizing the purified protein in a membrane-like environment.

  • Functional validation:

    • Challenge: Ensuring that the recombinant protein retains its native membrane fusion activity.

    • Solution: Develop cell-based fusion assays to confirm functionality before and after purification steps. The syncytiogenesis assay using appropriately susceptible cell lines serves as an effective functional validation approach .

Addressing these challenges requires systematic optimization of expression conditions, solubilization methods, and purification protocols specific to each aquareovirus FAST protein variant.

How can researchers optimize transfection efficiency for studying S7-encoded proteins?

Optimizing transfection efficiency is crucial for studying S7-encoded proteins, particularly when analyzing syncytium formation and protein-protein interactions. Consider these methodological approaches:

  • Cell line selection:

    • Different cell lines show varying susceptibility to aquareovirus infection and transfection.

    • For studying FAST proteins, use cell lines demonstrated to support syncytium formation (e.g., Vero, quail cells, or fish cell lines like GCF for aquareoviruses) .

    • Perform preliminary testing to identify the most responsive cell line for your specific construct.

  • Transfection reagent optimization:

    • Test multiple transfection reagents (Lipofectamine 2000, Lipofectamine 3000, FuGENE, jetPRIME, etc.).

    • Optimize the DNA:reagent ratio through a systematic titration series.

    • For the NSP5-based platform, Lipofectamine 2000 has been successfully used for co-transfection experiments .

  • DNA quality considerations:

    • Use high-quality plasmid preparations (A260/A280 ratio ~1.8-2.0).

    • Ensure plasmids are endotoxin-free, especially for sensitive cell lines.

    • Consider linearizing plasmids for more efficient integration in stable expression systems.

  • Transfection conditions:

    • Optimize cell density (typically 70-80% confluence works best).

    • Adjust incubation time with transfection complexes (4-6 hours is often optimal).

    • Consider serum-free media during complex formation but serum-containing media for the transfection period.

  • Co-transfection strategies:

    • For the NSP5-based platform, maintain consistent total DNA amounts when comparing different constructs.

    • Test different ratios of co-transfected plasmids to optimize protein expression levels.

    • Include appropriate controls (e.g., GFP-NSP5 alone, unrelated protein fusions) .

Implementing these optimizations will significantly improve transfection efficiency and experimental reproducibility when studying S7-encoded proteins .

What controls should be included when analyzing FAST protein-induced cell fusion?

Rigorous experimental design requires appropriate controls when analyzing FAST protein-induced cell fusion to ensure result validity and interpretability:

  • Negative controls:

    • Empty vector transfection: To confirm that syncytium formation is not due to transfection reagents or procedure.

    • Start codon mutation: Alter the CUG start codon to CCG to prevent FAST protein synthesis while maintaining the rest of the sequence intact (as demonstrated with MsReV NS22) .

    • Deletion mutants: Use constructs with deletions in functional domains to confirm domain-specific effects (e.g., constructs 15-613 and 17-613 for MsReV NS22) .

  • Positive controls:

    • Known fusogenic proteins: Include a well-characterized FAST protein or other viral fusogen.

    • Wild-type virus infection: When possible, include cells infected with the native virus to compare recombinant protein-induced fusion with natural infection.

  • Specificity controls:

    • Test for colocalization with markers of protein aggregation (poly-ubiquitin) or cytoskeletal elements (vimentin) to rule out non-specific protein aggregation .

    • Express the FAST protein in non-permissive cell lines to confirm cell type specificity.

  • Quantitative assessment controls:

    • Time-course analysis: Monitor fusion at multiple time points to establish kinetics.

    • Dose-response: Transfect varying amounts of expression constructs to establish relationship between protein expression and fusion activity.

    • Cell viability assays: Monitor cell viability to distinguish fusion events from cytotoxicity.

  • Visualization controls:

    • Nuclear staining (e.g., with Hoechst 33342) to clearly identify multinucleated syncytia .

    • Membrane staining to visualize cell boundaries.

    • For fluorescent fusion proteins, include both tagged and untagged versions to confirm that tags don't interfere with function.

Including these comprehensive controls ensures that the observed cell fusion effects can be confidently attributed to FAST protein activity rather than experimental artifacts .

What emerging technologies could advance our understanding of aquareovirus FAST proteins?

Several cutting-edge technologies hold promise for deepening our understanding of aquareovirus FAST proteins and their role in viral pathogenesis:

  • Cryo-electron microscopy (cryo-EM):

    • High-resolution structural determination of FAST proteins in membrane environments

    • Visualization of fusion intermediates to understand the membrane fusion mechanism

    • Structural comparison between different FAST protein variants from diverse aquareovirus strains

  • Single-molecule techniques:

    • FRET (Förster resonance energy transfer) to monitor conformational changes during fusion

    • Single-molecule tracking to study FAST protein dynamics in live cells

    • Optical tweezers to measure forces involved in membrane remodeling during fusion

  • Advanced imaging approaches:

    • Super-resolution microscopy to visualize FAST protein distribution and dynamics at the nanoscale

    • Live-cell imaging with fluorescent reporters to track fusion pore formation and expansion

    • Correlative light and electron microscopy to link FAST protein localization with membrane ultrastructure

  • Genomics and computational biology:

    • Comparative genomics across broader aquareovirus collections to identify evolutionary patterns

    • Molecular dynamics simulations to predict FAST protein behavior in membranes

    • Machine learning approaches to identify sequence determinants of fusion activity

  • Gene editing technologies:

    • CRISPR-Cas9 to create reporter fish lines for studying FAST protein function in vivo

    • Precise genome editing of aquareoviruses to study structure-function relationships

    • Cell engineering to identify host factors that modulate FAST protein activity

These technologies would provide unprecedented insights into the structure, function, and evolution of these unique viral fusogens, potentially leading to novel antiviral strategies for aquaculture .

How might understanding aquareovirus FAST proteins contribute to biotechnological applications?

Understanding aquareovirus FAST proteins could enable several innovative biotechnological applications:

  • Cell fusion technologies:

    • Development of controllable cell fusion systems for creating hybridomas or heterokaryons

    • Generation of multinucleated cells for studying nuclear-cytoplasmic interactions

    • Production of syncytia for developmental biology studies

  • Drug delivery platforms:

    • Engineering of minimal FAST protein domains as membrane-penetrating peptides

    • Development of liposome or nanoparticle systems incorporating FAST protein-derived sequences for enhanced cellular delivery

    • Creation of cell-penetrating systems that exploit the fusion mechanism for cytoplasmic delivery of biologics

  • Diagnostic tools:

    • FAST protein-based cell fusion assays for detecting neutralizing antibodies against aquareoviruses

    • Development of recombinant diagnostic antigens for serological surveillance

    • Reporter systems for monitoring viral infection and spread in research settings

  • Vaccine technologies:

    • FAST proteins as potential immunogens in aquaculture vaccines

    • Use of attenuated viruses with modified FAST proteins as live vaccines

    • Development of virus-like particles displaying FAST protein epitopes

  • Membrane research tools:

    • Model systems for studying fundamental aspects of membrane fusion

    • Probes for investigating lipid dynamics during fusion events

    • Tools for manipulating cell membrane properties in experimental systems

These applications could have significant impacts in fields ranging from aquaculture disease management to biomedical research and therapeutic development .

What are the major knowledge gaps in our understanding of aquareovirus S7 protein function and regulation?

Despite significant advances, several critical knowledge gaps remain in our understanding of aquareovirus S7 protein function and regulation:

  • Molecular mechanism of fusion:

    • The precise steps by which FAST proteins mediate membrane fusion remain poorly understood

    • The conformational changes that drive the fusion process have not been characterized

    • The energetics of FAST protein-mediated fusion need further investigation

  • Host factor interactions:

    • The cellular receptors or co-factors required for FAST protein function are largely unknown

    • How host cell membrane composition affects fusion efficiency is not well characterized

    • Potential host restriction factors that might limit FAST protein activity remain to be identified

  • Regulation of expression:

    • The mechanisms governing the use of noncanonical CUG start codons in viral mRNAs are not fully understood

    • How expression of FAST proteins is regulated during viral infection needs further investigation

    • The timing of FAST protein expression in relation to other viral processes requires clarification

  • Structure-function relationships:

    • High-resolution structures of FAST proteins are currently lacking

    • The specific contributions of different domains to the fusion process need further mapping

    • How structural variations between different FAST proteins affect their function remains incompletely understood

  • Evolutionary origins:

    • The evolutionary relationship between FAST proteins and other viral or cellular proteins is unclear

    • The mechanisms driving FAST protein diversification in different host environments need further exploration

    • Whether FAST proteins were acquired through horizontal gene transfer or evolved within the reovirus family remains uncertain

Addressing these knowledge gaps would significantly advance our understanding of these unique viral fusion proteins and potentially reveal new approaches for controlling aquareovirus infections in aquaculture settings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.