Recombinant Aquareovirus G Non-structural protein 5 (S7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
S7; Non-structural protein 5; NS5; NS16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Aquareovirus G (isolate American grass carp/USA/PB01-155/-) (AQRV-G)
Target Names
S7
Target Protein Sequence
MPCQDTVSLSIQHTHVIIQNSCCTTVSTSASTSATAYGLGCLALGCAGIAAAGICICCLI HGCPACPRRLGVRKQSSLSKQGHVSFHHLNPSDRVSRPYHPSCPTDVDLYLGGVQHDPDY VSHAQPIETQPQPLPPPPAYS
Uniprot No.

Target Background

Database Links

KEGG: vg:6218805

Protein Families
Aquareoviridae NS5 protein family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the genomic organization of the S7 segment in Aquareovirus G and what proteins does it encode?

The S7 genome segment of aquareoviruses is notably polycistronic, containing multiple open reading frames (ORFs). In Aquareovirus C and G (AQRV-C and AQRV-G), the S7 segment specifically contains two sequential ORFs encoding the nonstructural proteins NS16 and NS31 . This organization differs from that of Aquareovirus A (AQRV-A), where the S7 segment utilizes a noncanonical CUG translation start codon to produce a 22-kDa integral membrane protein responsible for syncytiogenesis .

The genomic structure is characterized by conserved terminal sequences, with all segments containing six conserved nucleotides at the 5' end and five conserved nucleotides at the 3' end (5'-GUUUUA ---- UCAUC-3'), which likely play critical roles in genome replication and packaging .

How do fusion-associated small transmembrane (FAST) proteins encoded by the S7 segment contribute to viral pathogenesis?

FAST proteins encoded by the S7 segment are directly responsible for cell-cell fusion and syncytium formation, a process termed syncytiogenesis . This function is particularly significant because aquareoviruses and orthoreoviruses are the only well-characterized examples of nonenveloped viruses that can induce syncytium formation .

The correlation between fusogenic activity and pathogenicity suggests that syncytium formation enhances both localized and systemic dissemination of viral infection . This is supported by observations that fusogenic aquareoviruses and orthoreoviruses are associated with a variety of clinical syndromes and disease states, while nonfusogenic species of orthoreoviruses typically do not cause natural infections with similar pathogenicity profiles .

What structural features distinguish the S7-encoded proteins of Aquareovirus G from other aquareovirus species?

The FAST proteins encoded by the S7 segment across different aquareovirus species display distinct structural characteristics. Sequence analysis indicates that AQRV-C and AQRV-G likely encode homologs of the reptilian orthoreovirus p14 FAST protein, rather than the AQRV-A p22 FAST protein . This suggests significant evolutionary divergence in this viral protein family.

Each FAST protein represents a distinct member of the family with a unique repertoire and arrangement of structural motifs . These proteins exhibit transmembrane domains that are essential for their membrane fusion activity, despite their relatively small size compared to typical viral fusion proteins .

What expression systems are optimal for producing recombinant S7-encoded proteins?

Based on proven methodologies, the baculovirus expression system represents one of the most effective approaches for producing recombinant aquareovirus proteins, including those encoded by the S7 segment. The implementation protocol involves:

  • Cloning the target gene into pFastbacI or pFastbac-dual vector systems

  • Transforming the recombinant plasmid into DH10Bac-competent cells

  • Isolating the recombinant bacmids and verifying them via PCR with either M13 primers or gene-specific primers

  • Transfecting the verified bacmids pre-mixed with the cationic liquid Cellfectin reagent into monolayers of Sf9 cells

  • Harvesting the cell suspension 3-5 days post-transfection to obtain P1 viral stock

  • Using this stock for further inoculation until a stable recombinant baculovirus is generated

This methodology has been successfully employed for the expression of various aquareoviral proteins including VP5 and VP7, and can be adapted for S7-encoded proteins .

What strategies can overcome challenges associated with non-canonical start codons in S7-encoded proteins?

The aquareovirus S7 segment notably uses non-canonical translation initiation sites, such as the CUG start codon observed in Atlantic salmon reovirus (AtSRV) . To successfully express these proteins:

  • Design expression constructs that retain the entire 5' region of the target ORF, including all upstream regulatory elements

  • Consider codon optimization while maintaining the non-canonical start site

  • Verify expression through Western blot analysis with protein-specific antibodies

  • If expression levels are low, evaluate alternative expression systems that may better accommodate non-canonical translation initiation

  • Consider creating fusion constructs with standard start codons while preserving key functional domains

The success of these approaches is evidenced by expression studies of the AtSRV S7 segment, where researchers were able to express a functional 22-kDa protein using its native non-canonical start codon .

What assays are most effective for confirming syncytiogenic activity of recombinant S7-encoded FAST proteins?

To evaluate the syncytiogenic activity of recombinant S7-encoded FAST proteins, the following methodological approaches have proven effective:

  • Transfection of cDNA expression constructs into appropriate cell lines (Vero or quail cells have been successfully used)

  • Microscopic observation of cell-cell fusion and syncytium formation at 24-48 hours post-transfection

  • Quantification of syncytium size and number using standardized scoring systems

  • Immunofluorescence analysis to confirm protein expression and localization

  • Time-lapse microscopy to document the progression of syncytium formation

The Atlantic salmon reovirus S7 cDNA expression in transfected cells resulted in extensive cell-cell fusion and syncytium formation, confirming that this methodology effectively demonstrates the functional activity of FAST proteins .

How can mutagenesis studies be designed to identify critical functional domains in S7-encoded proteins?

A systematic mutagenesis approach should involve:

  • Sequence analysis to identify conserved domains or motifs within the protein

  • Strategic insertion of stop codons into different ORFs to determine which predicted gene products are responsible for specific functions (as demonstrated with AtSRV p22 protein)

  • Site-directed mutagenesis targeting:

    • Predicted transmembrane domains

    • Potential myristoylation sites

    • Conserved amino acid residues

    • Regions with predicted secondary structures

  • Functional testing of each mutant using cell fusion assays

  • Biochemical analysis to determine protein stability and expression levels

This methodology proved successful in identifying the 22-kDa protein encoded by ORF2 as responsible for syncytium formation in AtSRV .

What post-translational modifications have been identified in S7-encoded proteins, and how do they affect function?

While specific post-translational modifications (PTMs) of S7-encoded proteins in Aquareovirus G have not been fully characterized, studies of other aquareovirus proteins provide valuable insights into likely modifications and their functional implications:

  • Myristoylation: In GCRV, myristoylated modifications embedded in the hydrophobic pockets of the VP5 N-terminus are critical for conformational transformation and membrane penetration. Similar modifications may occur in S7-encoded membrane proteins .

  • Phosphorylation: Studies have identified serine and threonine phosphorylation in viral capsid proteins, suggesting that similar modifications may regulate the activity of S7-encoded proteins .

  • Acetylation: Lysine acetylation has been observed in VP5 proteins, potentially affecting protein stability and interactions .

The presence of these modifications likely influences protein folding, membrane association, and fusion activity. Research methodology should include mass spectrometry analysis to identify PTMs in recombinant and native S7-encoded proteins .

How do S7-encoded proteins differ between fusogenic and non-fusogenic aquareoviruses?

Significant structural and functional differences exist between the S7-encoded proteins of fusogenic and non-fusogenic aquareoviruses:

  • Fusogenic aquareoviruses (like GCRV-I) contain S7 segments encoding FAST proteins responsible for cell-cell fusion and syncytium formation .

  • Non-fusogenic aquareoviruses (like GCRV-II) lack FAST proteins and instead harbor a predicted MRV-σ1 cognate cell attachment protein on the particle surface .

  • These differences directly influence cytopathic effects (CPE) in infected cell cultures, with fusogenic strains causing characteristic syncytium formation while non-fusogenic strains produce different CPE patterns .

  • The divergence likely reflects different evolutionary strategies for virus entry and spread, with fusogenic viruses using direct cell-cell fusion while non-fusogenic viruses rely on receptor-mediated entry mechanisms .

What phylogenetic relationships exist among S7-encoded proteins across aquareovirus species?

Phylogenetic analysis reveals distinct evolutionary patterns among aquareovirus S7-encoded proteins:

  • Aquareoviruses cluster in two primary groups:

    • One comprising isolates from freshwater fish

    • The other comprising isolates from marine fish

  • Within these groups, the S7-encoded proteins show varying degrees of sequence conservation, with some regions under high selective pressure and others exhibiting greater variability.

  • The S7 segment of Atlantic salmon reovirus (AtSRV) shares its highest amino acid sequence identity with proteins from Aquareovirus A species group .

  • Interestingly, sequence analysis suggests that AQRV-C and AQRV-G encode homologs of the reptilian orthoreovirus p14 FAST protein rather than the AQRV-A p22 FAST protein, indicating complex evolutionary relationships that transcend host species boundaries .

This phylogenetic distribution provides valuable insights into the evolution and host adaptation of these viruses and should inform approaches to recombinant protein design and functional studies .

How can recombinant S7-encoded proteins be utilized to study virus-host interactions?

Recombinant S7-encoded proteins provide powerful tools for investigating virus-host interactions through several methodological approaches:

  • Expression of individual proteins in cell culture systems to assess their effects on:

    • Cell membrane integrity

    • Cytoskeletal organization

    • Cell signaling pathways

    • Host immune responses

  • Creation of fluorescently tagged recombinant proteins to track localization and trafficking within host cells.

  • Identification of cellular binding partners through pull-down assays and mass spectrometry.

  • Development of antibodies against recombinant proteins for immunoprecipitation studies.

  • Establishment of stable cell lines expressing S7-encoded proteins to study long-term effects on host cell physiology .

These approaches can reveal critical aspects of the virus replication cycle and pathogenesis mechanisms, potentially identifying targets for therapeutic intervention .

What cellular factors influence the function of S7-encoded proteins during infection?

The function of S7-encoded proteins is influenced by various cellular factors:

  • Membrane composition: The lipid composition and fluidity of host cell membranes likely affect the fusion activity of FAST proteins.

  • Cytoskeletal elements: The actin and microtubule networks may facilitate or restrict syncytium formation.

  • Host proteases: Cellular proteases may be required for proper processing and activation of viral proteins.

  • Innate immune factors: Host cell antiviral responses may modulate the expression and function of viral proteins.

Methodological approaches to study these factors include:

  • Pharmacological inhibition of specific cellular pathways

  • siRNA knockdown of candidate host factors

  • CRISPR-Cas9 genome editing to generate knockout cell lines

  • Comparative studies in permissive versus non-permissive cell types

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.