Recombinant Aquifex aeolicus ATP synthase subunit c (atpE)

What is the molecular structure of Aquifex aeolicus ATP synthase subunit c?

The mature Aquifex aeolicus ATP synthase subunit c (atpE) is an 81 amino acid protein with a molecular weight of approximately 8.1 kDa . The full-length protein (including the signal peptide) consists of 100 amino acids with the following sequence: MMKRLMAILTAIMPAIAMAAEGEASVAKGLLYLGAGLAIGLAGLGAGVGMGHAVRGTQEGVARNPNAGGRLQTLMFIGLAFIETIALYGLLIAFILLFVV . Structurally, the mature protein consists of the conserved two-helix C-terminal motif characteristic of ATP synthase c-subunits, but notably, it initially contains an N-terminal signal peptide of 19 amino acids that is cleaved off post-translationally . This places it in phylogenetic group 2 of ATP synthase c-subunits based on the classification system developed by Zhang et al. .

How does Aquifex aeolicus atpE differ from other bacterial ATP synthase c-subunits?

Aquifex aeolicus atpE belongs to a distinctive category (group 2) of ATP synthase c-subunits characterized by the presence of an N-terminal signal peptide . Unlike the commonly studied E. coli c-subunit (which is classified as group 1 with a short N-terminal tail), the A. aeolicus protein contains a signal peptide with specific signal recognition particle (SRP) recognition features . These features include a positively charged n-region, a hydrophobic h-region, and a neutral polar c-region, along with specific residues involved in signal peptide cleavage (alanine at positions -3 and -1, and proline at position -6) . This structural difference suggests that A. aeolicus c-subunit follows a membrane insertion pathway different from that of the E. coli c-subunit and likely mediated by SRP .

What expression systems are suitable for recombinant production of Aquifex aeolicus atpE?

E. coli has been successfully employed as an expression system for recombinant production of Aquifex aeolicus ATP synthase subunit c . When expressing the full-length protein (including the N-terminal signal peptide), E. coli recognizes and cleaves the signal peptide, resulting in mature protein production . This indicates that E. coli possesses the necessary machinery to process the A. aeolicus signal peptide correctly. For optimal expression, the protein can be tagged (such as with an N-terminal His-tag) to facilitate purification . The recombinant protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 and is typically reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added for long-term storage at -20°C/-80°C .

How does the N-terminal signal peptide affect membrane insertion of Aquifex aeolicus atpE?

The N-terminal signal peptide of Aquifex aeolicus atpE plays a critical role in membrane insertion, as demonstrated through heterologous expression studies in E. coli . Zhang et al. designed three different constructs to investigate this role: (1) native c-subunit with its N-terminal signal peptide (pCL21), (2) a signal-peptide-deletion variant lacking the 18 amino acids after the start codon (pCL21-DSP), and (3) a hybrid construct where the N-terminal peptide was replaced with that of E. coli c-subunit (pCL21-MEN) .

Western blot analysis revealed successful expression only with the construct containing the native signal peptide (pCL21), while both modified constructs (pCL21-DSP and pCL21-MEN) failed to produce detectable protein . This was confirmed by chloroform/methanol extraction followed by MALDI-TOF MS analysis, which showed a clear peak at 8112.7 Da (corresponding to the mature c-subunit) only for the pCL21 construct . These findings demonstrate that the N-terminal signal peptide is obligatorily required for membrane insertion of A. aeolicus atpE, even in a heterologous system, suggesting it follows a distinct membrane insertion pathway that differs from that used by the native E. coli c-subunit .

What are the proposed membrane insertion pathways for Aquifex aeolicus atpE?

Based on the signal peptide characteristics and experimental evidence, three potential membrane insertion pathways have been proposed for Aquifex aeolicus atpE :

• YidC-only pathway: In this scenario, the signal peptide would be recognized by SRP, but membrane insertion would be mediated solely by YidC. Recognition by YidC would likely involve the three positively charged cytoplasmic loop residues, resulting in a mixed SRP/YidC pathway .

• YidC and SecYEG pathway: This would involve a mixed SRP/Sec/YidC pathway, similar to what has been proposed for ATP synthase a- and b-subunits .

• SecYEG-only pathway: In this case, membrane insertion would follow a classical SRP/SecYEG interaction .

The study by Zhang et al. suggests that A. aeolicus ATP synthase c-subunit follows a membrane insertion pathway in E. coli that differs from that of the E. coli ATP synthase c-subunit and is likely mediated by SRP . This pathway obligatorily requires the presence of an N-terminal signal peptide, which appears to be a characteristic of certain ATPases, particularly those from early diverging organisms and extremophiles .

What experimental techniques are most effective for studying the membrane topology of Aquifex aeolicus atpE?

Several complementary techniques have proven effective for studying the membrane topology and processing of Aquifex aeolicus atpE:

• Mass spectrometry: MALDI-TOF mass spectrometry has been successfully used to determine the true size of the mature c-subunit (8.1 kDa), confirming the cleavage of the N-terminal 19 amino acids . This technique is particularly valuable for precise molecular weight determination and verification of post-translational modifications.

• Chloroform/methanol extraction: This method effectively isolates the hydrophobic c-subunit from membrane preparations and is compatible with subsequent mass spectrometry analysis .

• Western blot analysis: Using polyclonal antibodies against the cytoplasmic loop of the c-subunit provides a sensitive method for detecting expression in different constructs .

• Heterologous expression studies: Comparing the expression of different constructs (with and without the signal peptide) in E. coli provides valuable insights into the functional importance of specific protein regions .

• Bioinformatic analysis: Multiple sequence alignment and classification approaches can identify conserved motifs and structural features that may be functionally significant .

For comprehensive topology studies, researchers should consider combining these approaches with additional techniques such as cysteine scanning mutagenesis, fluorescence spectroscopy, or cryo-electron microscopy to obtain structural information at higher resolution.

What purification strategies are recommended for recombinant Aquifex aeolicus atpE?

For high-purity isolation of recombinant Aquifex aeolicus atpE, the following purification strategy is recommended:

• Expression optimization: Express the full-length protein (including the signal peptide) in E. coli with an N-terminal His-tag to facilitate purification . It is critical to include the signal peptide, as constructs lacking this region fail to express properly .

• Cell lysis and membrane preparation: Harvest cells and disrupt them using methods suitable for membrane proteins (e.g., French press, sonication). Separate the membrane fraction by ultracentrifugation.

• Protein extraction: Extract the c-subunit from membranes using chloroform/methanol (typically 2:1 v/v) . This approach is particularly effective for isolating highly hydrophobic membrane proteins like atpE.

• Affinity chromatography: If using His-tagged constructs, purify the protein using nickel affinity chromatography under conditions optimized for membrane proteins (typically including detergents) .

• Quality control: Verify the purity using SDS-PAGE (>90% purity is achievable) and confirm the molecular weight using MALDI-TOF mass spectrometry (expected mass of mature protein: 8.1 kDa) .

The purified protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . For long-term storage, add glycerol to a final concentration of 5-50% and store at -20°C or -80°C in small aliquots to avoid repeated freeze-thaw cycles .

How can researchers effectively analyze the signal peptide processing of Aquifex aeolicus atpE?

To effectively analyze the signal peptide processing of Aquifex aeolicus atpE, researchers should consider the following methodological approach:

• Construct design: Create multiple constructs, including:

  • Full-length protein with native signal peptide

  • Truncated versions lacking the signal peptide

  • Chimeric constructs with signal peptides from different organisms

  • Point mutations in key residues involved in signal peptide recognition or cleavage

• Expression system selection: Use both homologous and heterologous expression systems to compare processing efficiency. E. coli has been demonstrated to correctly process the A. aeolicus signal peptide .

• Detection methods:

  • Western blot analysis using antibodies specific to different regions of the protein

  • MALDI-TOF mass spectrometry to precisely determine the molecular weight of processed forms

  • N-terminal sequencing to confirm the exact cleavage site

• Time-course experiments: Monitor the kinetics of signal peptide processing by collecting samples at different time points after induction.

• Inhibitor studies: Use specific inhibitors of signal peptidase or components of the SRP pathway to confirm the mechanism of processing.

By systematically applying these methods, researchers can gain comprehensive insights into the signal peptide processing mechanism and its importance for membrane insertion of A. aeolicus atpE.

How can researchers interpret phylogenetic classification of ATP synthase c-subunits?

The phylogenetic classification of ATP synthase c-subunits provides valuable insights into evolutionary relationships and functional adaptations. Based on the analysis by Zhang et al., c-subunits can be categorized into four distinct groups :

When interpreting phylogenetic data for ATP synthase c-subunits, researchers should consider:

• Evolutionary context: The presence of specific features like signal peptides in certain groups (particularly early diverging organisms and extremophiles) may reflect ancient insertion mechanisms or adaptations to extreme environments .

• Structural implications: N-terminal variations directly impact the membrane topology and potentially the assembly process of the ATP synthase complex .

• Functional significance: Different insertion pathways may reflect adaptations to specific cellular environments or energetic requirements .

• Cross-species comparisons: Comparing c-subunits across diverse species can reveal conserved functional elements versus adaptable regions .

This classification system provides a framework for understanding the evolution of membrane protein biogenesis pathways and may guide experimental approaches for studying specific c-subunit variants.

What factors should be considered when analyzing experimental results with recombinant Aquifex aeolicus atpE?

When analyzing experimental results with recombinant Aquifex aeolicus atpE, researchers should consider several critical factors:

• Expression system compatibility: A. aeolicus is a hyperthermophilic bacterium, and its proteins may behave differently in mesophilic expression hosts like E. coli. While E. coli can correctly process the signal peptide, other aspects of protein folding or stability may be affected by the expression environment .

• Tag effects: N-terminal His-tags or other affinity tags may influence protein behavior, particularly for membrane proteins where terminal regions can be functionally important . Control experiments with differently tagged constructs or tag-free proteins may be necessary.

• Membrane composition differences: The lipid composition of A. aeolicus membranes differs from that of mesophilic bacteria, which may affect the folding, stability, or function of recombinant atpE .

• Temperature considerations: Native A. aeolicus grows at extremely high temperatures (85-95°C), while recombinant expressions are typically performed at lower temperatures. This difference may affect protein conformation and stability .

• Detergent selection: The choice of detergents for extraction and purification can significantly impact the structural integrity and functional properties of membrane proteins like atpE .

• Post-translational processing: Verification of correct signal peptide cleavage is essential, as incorrect processing could lead to misfolded or non-functional protein .

By carefully considering these factors, researchers can more accurately interpret experimental results and develop robust protocols for working with this challenging protein.

What are the potential applications of studying Aquifex aeolicus atpE in extremophile biology?

Studying Aquifex aeolicus atpE offers several promising applications in extremophile biology:

• Thermostable protein engineering: Understanding the structural adaptations that allow A. aeolicus atpE to function at extreme temperatures could inform the design of thermostable proteins for industrial applications .

• Ancient protein insertion mechanisms: As A. aeolicus represents one of the earliest diverging bacterial lineages, its unique signal peptide-dependent membrane insertion pathway may provide insights into ancient membrane protein biogenesis mechanisms that have been modified or lost in more recently evolved organisms .

• Extremophile membrane adaptation: The specific requirements for membrane insertion of A. aeolicus atpE may reflect broader adaptations in membrane composition and protein insertion machinery that enable survival in extreme environments .

• Evolution of energy conservation mechanisms: The ATP synthase complex is a central component of cellular energy metabolism, and variations in its assembly and structure across phylogenetic groups may reveal evolutionary adaptations in energy conservation strategies .

• Novel antibiotic targets: Understanding unique aspects of membrane protein insertion in phylogenetically distant organisms could potentially identify novel targets for antimicrobial development that specifically target these pathways without affecting human cells.

Further research into these areas could significantly enhance our understanding of extremophile biology and potentially lead to biotechnological applications leveraging the unique properties of these organisms.

What unresolved questions remain about Aquifex aeolicus atpE membrane insertion and assembly?

Despite significant advances in understanding Aquifex aeolicus atpE, several important questions remain unresolved:

• Precise insertion pathway: While the requirement for an N-terminal signal peptide has been established, the exact membrane insertion pathway (YidC-only, YidC/SecYEG, or SecYEG-only) remains to be definitively determined .

• Assembly into the ATP synthase complex: How the mature c-subunit assembles with other ATP synthase components in A. aeolicus and whether this process differs from that in organisms with different c-subunit types requires further investigation .

• Functional implications: Whether the unique insertion mechanism of A. aeolicus atpE correlates with specific functional or structural adaptations in the assembled ATP synthase complex remains unclear .

• Temperature adaptation: The relationship between the signal peptide-dependent insertion mechanism and the thermophilic lifestyle of A. aeolicus has not been fully explored .

• Recognition elements: The specific sequence or structural elements within the signal peptide that are recognized by the SRP and membrane insertion machinery need to be more precisely defined .

• Evolutionary origin: The evolutionary history of this distinct membrane insertion pathway and whether it represents an ancestral trait or a specialized adaptation requires further phylogenetic analysis .

Addressing these questions will require a combination of biochemical, genetic, and structural approaches, potentially including in vitro reconstitution of membrane insertion pathways, high-resolution structural studies, and comparative genomics across extremophiles.