Recombinant Aquifex aeolicus Biopolymer transport protein exbB (exbB)

Shipped with Ice Packs
In Stock

Description

Introduction

The ExbB protein is a component of the ExbB-ExbD-TonB complex, which is essential for energy-dependent transport across the outer membrane in Gram-negative bacteria . This complex harnesses energy from the proton motive force (PMF) of the cytoplasmic membrane to facilitate the transport of essential nutrients, such as iron siderophores, through TonB-dependent transporters (TBDTs) . Aquifex aeolicus, a thermophilic bacterium, also possesses an ExbB homolog that plays a crucial role in nutrient uptake .

Function and Mechanism

ExbB is involved in the TonB-dependent, energy-driven transport of various receptor-bound substrates . It protects ExbD from proteolytic degradation and functionally stabilizes TonB . The ExbB protein appears to be the scaffold on which TonB and ExbD assemble . In its absence, both proteins are proteolytically unstable, while ExbB is stable .

The ExbB-ExbD-TonB complex is anchored in the cytoplasmic membrane and energizes the transport of scarce nutrients across the outer membrane . This process is vital because the outer membrane is otherwise impermeable to large molecules .

Structure and Composition

ExbB is the most abundant protein in the ExbB-ExbD-TonB complex and stabilizes TonB and ExbD . Isolated ExbB forms a stable homooligomer with four to six monomers . It is proposed that the ExbB homooligomer forms a platform on which ExbD and TonB are assembled to form the energy-transducing complex in the cytoplasmic membrane .

Aquifex aeolicus ExbB

Aquifex aeolicus lacks a bifunctional MnmC protein fusion and instead encodes the Rossmann-fold protein DUF752, which is homologous to the methyltransferase . A. aeolicus has genes encoding the MnmE, MnmG, and MnmA, but only one gene encoding a shorter version of MnmC (DUF752) .

Interactions and Dynamics

ExbB interacts with ExbD and TonB, and serves as a scaffolding protein for their assembly . ExbD is degraded in the absence of ExbB, highlighting ExbB's role in stabilizing ExbD and TonB .

Three stages of interactions between the ExbB, ExbD, and TonB proteins have been proposed . The highly dynamic, disordered ExbD domain is of particular importance in this process .

Homologs and Evolutionary Aspects

Comparative genomics reveals that ExbB homologs are widespread in Gram-negative bacteria, reflecting the conserved nature of the TonB-dependent transport system . While sequence similarity may be low, the functional roles of ExbB, ExbD, and TonB are generally conserved .

Table: Key Features of Aquifex aeolicus ExbB

FeatureDescription
Target NamesexbB
SynonymsexbB; aq_1757; Biopolymer transport protein ExbB
SpeciesAquifex aeolicus (strain VF5)
Protein LengthFull length protein
FunctionInvolved in TonB-dependent, energy-driven transport of various receptor-bound substrates; protects ExbD from proteolytic degradation and functionally stabilizes TonB .
Uniprot No.O67637
Expression Region1-148
Target Protein SequenceMMEEIKELIDYGIMGTLLFMSFVALAVGIERYLSIRSTKVENFKSKAQLEKELTKRLYII ATVASNAPYVGLLGTVLGILLTFYIIGEKGIVNTKEIMVGLALALKATALGLIVAIPSTI LYNFLVRKVREKLLDWEAIHGECSSSHE

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
exbB; aq_1757; Biopolymer transport protein ExbB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
exbB
Target Protein Sequence
MMEEIKELIDYGIMGTLLFMSFVALAVGIERYLSIRSTKVENFKSKAQLEKELTKRLYII ATVASNAPYVGLLGTVLGILLTFYIIGEKGIVNTKEIMVGLALALKATALGLIVAIPSTI LYNFLVRKVREKLLDWEAIHGECSSSHE
Uniprot No.

Target Background

Function
This protein is involved in TonB-dependent, energy-driven transport of various receptor-bound substrates. It protects ExbD from proteolytic degradation and functionally stabilizes TonB.
Database Links

KEGG: aae:aq_1757

STRING: 224324.aq_1757

Protein Families
ExbB/TolQ family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Aquifex aeolicus and why is its ExbB protein significant for research?

Aquifex aeolicus is a hyperthermophilic bacterium that serves as the model organism for the deeply rooted phylum Aquificae. It is colloquially known as a "water-maker" due to its H₂-oxidizing microaerophilic metabolism that allows it to flourish in extremely hot marine habitats, particularly volcanic environments rich in sulfur compounds . This organism possesses hyper-stable proteins and a fully sequenced genome, making it valuable for understanding extremophile biology .

The ExbB protein from A. aeolicus is particularly significant because it belongs to a family of biopolymer transport proteins that are critical components of energy-transducing systems in gram-negative bacteria. ExbB works in conjunction with ExbD and TonB to form the Ton system, which couples cytoplasmic membrane proton motive force to active transport of diverse nutrients across the outer membrane . Studying the A. aeolicus ExbB provides insights into molecular adaptations that enable protein function at extreme temperatures.

How does ExbB function within bacterial transport systems?

ExbB functions as part of the TonB-dependent transport system in gram-negative bacteria. This system is responsible for importing essential nutrients such as iron and vitamin B12 through outer membrane receptors . The transport process utilizes proton motive force harvested by the Ton system, which comprises three inner membrane proteins: ExbB, ExbD, and TonB .

Within this system:

  • ExbB and ExbD form proton channels that energize the transport process

  • ExbB serves as the scaffold for complex assembly, forming either pentameric or hexameric structures

  • These complexes enclose ExbD transmembrane helices within their central channel

  • The assembled complex harvests energy from proton motive force and transfers it to TonB

  • TonB then interacts directly with outer membrane transporters to facilitate nutrient uptake

The mechanistic model suggests that ExbB undergoes conformational changes associated with proton translocation, allowing the system to couple ion flow to mechanical work needed for transport .

What are the optimal storage and handling conditions for recombinant Aquifex aeolicus ExbB protein?

For optimal stability and activity of recombinant A. aeolicus ExbB protein, the following storage and handling guidelines should be followed:

Storage Conditions:

  • Liquid form: 6 months at -20°C/-80°C

  • Lyophilized form: 12 months at -20°C/-80°C

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot for long-term storage at -20°C/-80°C

Working Conditions:

  • For short-term work, store aliquots at 4°C for up to one week

  • Avoid repeated freezing and thawing cycles as this significantly reduces protein stability

What is known about the oligomeric states of ExbB complexes?

Research has revealed that ExbB can exist in two different oligomeric states: pentameric and hexameric complexes. These structures have been elucidated through various techniques including X-ray crystallography and single-particle cryo-EM .

Comparative Characteristics of ExbB Oligomeric States:

FeaturePentameric ComplexHexameric Complex
Composition5 ExbB subunits + 1 ExbD TM domain6 ExbB subunits + 3 ExbD TM domains
pH DependencyFavored at lower pHProportion increases with pH
ConfigurationExbB₅ExbD₁ᵀᴹExbB₆ExbD₃ᵀᴹ
Channel PropertiesSmaller central poreLarger central channel
FunctionMay represent inactive stateMay represent active state

The transition between these oligomeric states appears to be pH-dependent, with the proportion of hexameric complexes increasing at higher pH values . Both channel current measurement and 2D crystallography support the existence and transition of these two oligomeric states in membranes .

Additionally, research on the ExbB-ExbD complex from Serratia marcescens has shown that ExbB forms a stable pentamer both alone and in complex with ExbD, with the complex displaying an ExbB₅-ExbD₂ stoichiometry . This is similar to observations for ExbB-ExbD complexes from Escherichia coli and Pseudomonas savastanoi .

How is the transmembrane domain organization of ExbB defined?

The transmembrane domain (TMD) organization of ExbB has been extensively studied, with recent reassessments providing more accurate definitions of the boundaries:

ExbB has an N-terminus-out, C-terminus-in topology with three transmembrane domains (TMDs). TMDs 1 and 2 are separated by a cytoplasmic loop, with the C-terminal tail also residing in the cytoplasm .

Refined TMD Boundaries:
Previous predictions of TMD boundaries were widely divergent, but recent reassessments based on hydrophobic character and residue conservation among distantly related ExbB proteins have brought these predictions into congruence . This reevaluation has been critical for understanding structure-function relationships.

Functional Roles of TMDs:

  • TMD1: Mediates interaction with the TonB TMD

  • TMD2 and TMD3: The most conserved domains among the ExbB/TolQ/MotA/PomA family, involved in signal transduction between cytoplasm and periplasm and in the transition from ExbB homodimers to homotetramers

Interestingly, despite their essential roles, ExbB TMD residues appear to be excluded from direct participation in a proton pathway .

What crystallization techniques have been successful for studying ExbB protein structure?

Successful crystallization of ExbB complexes has been achieved using specific techniques and conditions:

Sample Preparation Protocol:

  • Concentrate protein samples to approximately 10 mg/ml

  • Subject to extensive screening over sparse matrix conditions using a Mosquito crystallization robot (TTP Labtech)

  • Grow crystals by hanging-drop vapor diffusion at 20°C

Successful Mother Liquor Composition:

  • 0.1 M glycine, pH 9.0

  • 0.15 M CaCl₂

  • ~40% PEG 350 MME

  • 0.05–0.2 M L-arginine

Under these conditions, plate-like crystals of approximately 100 μm × 100 μm × 10 μm grew over 1–2 months. For hexagonal crystals, mother liquors at pH 5.4 were effective .

Model Construction Approach:
Atomic models of the ExbB hexamer and ExbD TM trimer (ExbB₆ExbD₃ᵀᴹ) and the ExbB pentamer and ExbD TM monomer (ExbB₅ExbD₁ᵀᴹ) were constructed based on cryo-EM maps using software such as COOT, with subsequent refinement using Phenix.refine .

How can researchers effectively study ExbB-ExbD interactions in vivo?

Several methodological approaches have proven effective for investigating ExbB-ExbD interactions in living bacterial cells:

Proteinase K Sensitivity Assays:
This technique has been instrumental in identifying three stages in the initial energization of TonB at the cytoplasmic membrane:

  • Stage I: TonB and ExbD not detectably associated

  • Stage II: TonB and ExbD periplasmic domains assemble (pmf-independent)

  • Stage III: TonB and ExbD undergo pmf-dependent conformational rearrangement

Formaldehyde Cross-linking:
In vivo formaldehyde cross-linking can capture transient protein-protein interactions, revealing that:

  • TonB and ExbD form cross-links only in the presence of both pmf and ExbB

  • This technique can monitor the progression of TonB energization through different stages

Disulfide Trapping:
Introducing cysteine residues at specific locations can trap protein complexes in defined conformations:

  • Trapping of disulfide-linked ExbD homodimers through T42C or V43C mutations prevented TonB system activity

  • Activity was restored by adding reducing agent dithiothreitol, indicating a requirement for motion

  • This suggests that ExbD transmembrane domains undergo rotational motion during function

Photo-cross-linking:
In vivo photo-cross-linking experiments have suggested that ExbD transmembrane domains rotate during the energy transduction process .

What techniques are used to investigate pH-dependent structural changes in ExbB complexes?

The pH-dependent transitions between pentameric and hexameric ExbB complexes have been studied using complementary techniques:

Cryo-electron Microscopy:

  • Single-particle cryo-EM has been used to determine structures of both pentameric and hexameric complexes

  • Image analysis revealed that the proportion of hexameric complexes increases with pH

Channel Current Measurement:

  • Electrophysiological techniques can detect changes in channel properties as the complex transitions between oligomeric states

  • These measurements support the existence of both states in membranes

2D Crystallography:

  • This technique provides structural information about membrane proteins in a lipid environment

  • 2D crystallography has confirmed the pH-dependent transition between oligomeric states

Computational Approaches:

  • Electrostatic distributions calculated using PDB2PQR and displayed using APBS

  • These calculations help understand how pH affects protein interactions and complex formation

How does the ExbB protein from A. aeolicus compare with homologs from other bacterial species?

The ExbB protein from A. aeolicus shares functional similarities with homologs from other bacterial species while exhibiting distinct characteristics reflective of its extremophilic nature:

Comparative Analysis Across Species:

FeatureA. aeolicus ExbBE. coli ExbBS. marcescens ExbB
Thermal StabilityHyper-stable at high temperaturesMesophilic stabilityMesophilic stability
N-terminal ExtensionNot specifically mentionedAbsent~40 residues long periplasmic extension
Oligomeric StateLikely pentameric/hexamericPentameric/hexamericStable pentamer
Partner SpecificityNot specifiedInteracts with TonBExtension interacts with HasB (TonB paralog)

The S. marcescens ExbB represents a distinct class of ExbB proteins with a long N-terminal extension that is involved in specific interactions with HasB, a dedicated TonB paralog from the heme acquisition system . This extension is absent in E. coli ExbB.

While the A. aeolicus ExbB has not been as extensively characterized in terms of protein-protein interactions, its adaptation to extreme environments likely confers unique structural properties that enhance stability at high temperatures, similar to other proteins from this organism.

What is the role of key transmembrane residues in ExbB function and energy transduction?

Comprehensive mutagenesis studies have revealed the functional importance of specific transmembrane residues in ExbB:

TMD Residue Analysis:
All TMD residues with potentially function-specific side chains (Lys, Cys, Ser, Thr, Tyr, Glu, and Asn) and residues with probable structure-specific side chains (Trp, Gly, and Pro) were substituted with Ala and evaluated in multiple assays .

Key Findings:

  • All three TMDs are essential but have different roles

  • TMD1 mediates interaction with the TonB TMD

  • TMD2 and TMD3 (most conserved domains) are involved in signal transduction between cytoplasm and periplasm

  • These conserved domains also facilitate the transition from ExbB homodimers to homotetramers

The first transmembrane helix (TM1) of ExbB contains specificity determinants for interaction with TonB or its paralogs (like HasB in S. marcescens) . In ExbD, the Asp25 residue plays a pivotal role in TonB system response to cytoplasmic membrane proton motive force, with both charge and location being critical .

Interestingly, despite the involvement of ExbB in energy transduction, combined data exclude ExbB TMD residues from direct participation in a proton pathway .

How do ExbB-ExbD complexes harness proton motive force for energy transduction?

The mechanism by which ExbB-ExbD complexes harness proton motive force (pmf) involves several coordinated steps:

Current Mechanistic Model:

  • ExbB forms a scaffold (pentameric or hexameric) in the cytoplasmic membrane

  • ExbD transmembrane helices insert into the central channel of ExbB

  • Proton translocation through the complex induces conformational changes

  • These changes are transmitted to the periplasmic domains of ExbD

  • ExbD then interacts with TonB, transferring energy for active transport

Key Experimental Evidence:

  • ExbB facilitates but is not essential for the initial pmf-independent TonB-ExbD interaction (Stage II)

  • In the absence of ExbB, only a small proportion of TonB forms a proteinase K-resistant fragment, indicating that ExbB greatly enhances TonB-ExbD assembly

  • The progression from Stage II to Stage III (formation of TonB-ExbD cross-links) absolutely requires both pmf and ExbB

Structural Transitions:
The hexameric and pentameric forms may represent different functional states of the complex:

  • The hexameric complex consists of six ExbB subunits and three ExbD transmembrane helices

  • The pentameric form contains five ExbB subunits and one ExbD transmembrane helix

  • The transition between these states may be part of the energy transduction cycle

  • pH affects the distribution between these states, suggesting proton involvement in structural transitions

It's worth noting that recent cryo-EM structures may not yet capture the complete mechanism by which these complexes utilize pmf, as evidence suggests dynamic movements (like rotation of ExbD transmembrane domains) are essential for function .

What is the evolutionary relationship of A. aeolicus ExbB to other bacterial transport systems?

The evolutionary history of A. aeolicus ExbB must be considered within the complex phylogenetic context of A. aeolicus itself:

Phylogenetic Context:
A. aeolicus has a complex evolutionary history characterized by extensive lateral gene transfer (LGT). Its genes show affiliations to many other lineages, including:

  • Hyperthermophilic Thermotogae

  • Proteobacteria (especially Epsilonproteobacteria)

  • Archaea

Phylogenomic Analysis Findings:

Functional System Evolution:
ExbB belongs to a larger family of molecular motors involved in:

  • Nutriment import across the outer membrane (ExbBD)

  • Flagellar rotation (MotAB)

  • Late steps of cell division in Gram-negative bacteria (TolQR)

This evolutionary relationship is reflected in structural similarities. For example, the most conserved regions of ExbB (TMD2 and TMD3) are shared among the ExbB/TolQ/MotA/PomA family , suggesting ancient evolutionary relationships among these energy-transducing systems.

The complex evolutionary history of A. aeolicus ExbB likely reflects both vertical inheritance and lateral gene transfer events that have shaped the Aquificae lineage.

What potential does the A. aeolicus ExbB system have for biotechnological applications?

A. aeolicus ExbB and other proteins from this hyperthermophile present several promising avenues for biotechnological applications:

Thermostable Protein Engineering:

  • A. aeolicus proteins exhibit exceptional thermal stability, with the organism flourishing at extremely high temperatures

  • The hyper-stable nature of these proteins makes them valuable templates for engineering thermostable enzymes for industrial processes

  • Understanding the structural features that confer thermostability to A. aeolicus ExbB could inform the design of robust membrane proteins for biotechnology

Antimicrobial Development:
Research on ExbD, which partners with ExbB, has revealed potential antimicrobial strategies:

  • A conserved site of ExbD interaction with TonB has been identified

  • Exogenous addition of a cyclic peptide based on that site inhibits ExbD-TonB interaction while decreasing iron transport efficiency

  • This suggests a novel antimicrobial strategy against ESKAPE and other Gram-negative pathogens by targeting protein-protein interactions in the TonB system

  • Similar approaches could target the ExbB component of this system

Bioenergy Applications:

  • A. aeolicus possesses efficient energy conservation mechanisms adapted to extreme environments

  • Its ExbB-ExbD system harnesses proton motive force for energy transduction

  • Understanding this mechanism could inform the design of biomimetic energy conversion systems

  • The carbon fixation abilities of A. aeolicus, which assimilates CO₂ via the reverse tricarboxylic acid cycle (rTCA), also present opportunities for carbon capture technologies

Structural Biology Tools:

  • The stable oligomeric complexes formed by ExbB (pentamers and hexamers) could serve as scaffolds for designing novel nanopores or membrane protein assemblies

  • These engineered complexes could have applications in biosensing, controlled delivery, or synthetic biology

Research on A. aeolicus ExbB and its partner proteins continues to reveal new insights with potential translational applications in biotechnology and medicine.

What are common challenges in expressing and purifying recombinant A. aeolicus ExbB protein?

Researchers working with recombinant A. aeolicus ExbB protein may encounter several challenges:

Expression Challenges:

  • A. aeolicus proteins are typically expressed in mesophilic hosts like E. coli, creating potential folding issues due to temperature differences

  • Membrane proteins like ExbB are generally difficult to express in high yields

  • The hydrophobic nature of transmembrane domains can lead to toxicity in host cells or inclusion body formation

Purification Considerations:

  • When purifying ExbB, tag selection is important. The tag type is typically determined during the manufacturing process

  • For analytical work, protein purity should be >85% as verified by SDS-PAGE

  • Membrane proteins require detergents for extraction and purification, and detergent selection is critical

Stability Solutions:

  • To maintain stability, add 5-50% glycerol (final concentration) when storing the protein

  • For optimal results, aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freezing and thawing cycles

  • For short-term work, store aliquots at 4°C for up to one week

Reconstitution Protocol:

  • Centrifuge the vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to final concentration of 5-50% (50% is recommended)

How can researchers effectively study pH-dependent oligomeric transitions of ExbB?

To study the pH-dependent transitions between pentameric and hexameric ExbB complexes, researchers can employ multiple complementary approaches:

Experimental Design Strategy:

  • Protein Preparation at Controlled pH:

    • Purify ExbB in buffers with well-defined pH ranges (e.g., pH 5.4 to pH 9.0)

    • Maintain stable buffer conditions with appropriate buffering agents

  • Structural Analysis Techniques:

    • Employ single-particle cryo-EM for high-resolution structural determination at different pH values

    • Use native mass spectrometry to determine oligomeric state distribution

    • Apply 2D crystallography for membrane-embedded structural information

  • Functional Characterization:

    • Conduct channel current measurements to detect functional differences between oligomeric states

    • Correlate channel properties with structural transitions

  • Computational Approaches:

    • Calculate electrostatic distributions using tools like PDB2PQR and APBS

    • Model pH-dependent interactions and predict transition points

Critical Controls:

  • Include buffer-only controls to account for pH effects on instruments

  • Use pH-insensitive proteins as negative controls

  • Include well-characterized membrane proteins with known pH responses as positive controls

This multi-technique approach allows researchers to comprehensively characterize both structural and functional aspects of pH-dependent ExbB transitions.

What are promising avenues for further research on A. aeolicus ExbB protein?

Several promising research directions could advance our understanding of A. aeolicus ExbB:

Structural Dynamics Investigation:

  • Apply time-resolved cryo-EM to capture intermediate states during oligomeric transitions

  • Use single-molecule techniques to monitor conformational changes during function

  • Develop FRET-based assays to track domain movements in real-time

Comparative Systems Biology:

  • Compare the ExbB-ExbD-TonB system from A. aeolicus with homologous systems from mesophilic bacteria

  • Identify adaptations specific to thermophilic environments

  • Investigate co-evolution patterns between system components

Energy Transduction Mechanism:

  • Develop assays to directly measure proton translocation through ExbB-ExbD complexes

  • Map the complete energy transfer pathway from proton gradient to mechanical work

  • Characterize the role of specific residues in coupling proton movement to conformational changes

Functional Reconstitution:

  • Reconstitute the complete A. aeolicus Ton system in proteoliposomes

  • Measure transport activities under different conditions (temperature, pH)

  • Assess the impact of lipid composition on system function

Biotechnological Applications:

  • Engineer thermostable ExbB variants with enhanced or modified functions

  • Develop ExbB-based nanopores for sensing applications

  • Explore potential of ExbB-targeting peptides as novel antimicrobials

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.