Recombinant Aquifex aeolicus Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests. If you have a specific format preference, please indicate it in your order notes, and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for accurate delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles to maintain product integrity.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
plsY; aq_676; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-192
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
plsY
Target Protein Sequence
MKALFLVIFAYLLGSITFGEVIAKLKGVDLRNVGSGNVGATNVTRALGKKYGVLVFFLDF LKGFIPALIAVKSFGIDSWVLTFTGLASVLGHMYPVFFGFKGGKGVATALGVVFAVSPSV ALFSFLVWLGIFLWKRYVSLASITATISAFLFLFVAGYPVNVLFMAIVIGALIIYRHREN INRLLTGREHRF
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). While it utilizes acyl-phosphate as the fatty acyl donor, it does not utilize acyl-CoA or acyl-ACP.
Database Links

KEGG: aae:aq_676

STRING: 224324.aq_676

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of PlsY in bacterial phospholipid biosynthesis?

PlsY is a critical membrane-bound enzyme that catalyzes the first and rate-limiting step in phospholipid biosynthesis by transferring an acyl group from acyl donors to glycerol-3-phosphate (G3P). Specifically, PlsY catalyzes the acylation of the sn-1 position of G3P to generate lysophosphatidic acids (LPAs), which serve as precursors for membrane phospholipid synthesis . In most Gram-positive bacteria, including many pathogens, PlsY represents the only acyltransferase responsible for this essential metabolic step, which positions it as a potential target for antibiotic development . The reaction catalyzed by PlsY is fundamental to cellular membrane formation and consequently to bacterial survival and proliferation.

Unlike eukaryotic systems which often possess multiple GPAT isoforms with distinct subcellular localizations (such as mitochondrial GPAT1/GPAT2 or endoplasmic reticulum-associated GPAT3/GPAT4), bacterial systems typically rely solely on PlsY for this critical initial step in phospholipid synthesis . This streamlined pathway in bacteria makes PlsY particularly important as a biological catalyst and potential therapeutic target.

What expression systems are recommended for recombinant A. aeolicus PlsY production?

Based on the thermophilic nature of Aquifex aeolicus, which grows optimally at extremely high temperatures, specialized expression systems are required to produce functionally active recombinant PlsY. While the search results don't specifically address PlsY expression systems, approaches used for other A. aeolicus enzymes provide valuable guidance.

  • Use of E. coli strains optimized for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3))

  • Lower induction temperatures (16-25°C) despite the thermophilic nature of the target protein

  • Reduced IPTG concentrations (0.1-0.5 mM) for slower expression

  • Inclusion of specific membrane-mimicking environments during purification

The enzyme remains active at temperatures ranging from 55-65°C, as observed with other A. aeolicus enzymes, which should be considered during functional characterization . Expression trials should incorporate detergents suitable for membrane protein solubilization while maintaining the protein's native conformation and activity.

How can I verify the functional activity of recombinant A. aeolicus PlsY?

Functional verification of recombinant A. aeolicus PlsY can be accomplished through several complementary approaches:

Enzyme Activity Assay: The primary approach involves measuring the acyltransferase activity using G3P and a suitable acyl donor as substrates. A detergent micelle-based assay system has been developed for PlsY that allows continuous monitoring of phosphate release, one of the reaction products . This approach uses a fluorescently labeled phosphate binding protein as a sensor and offers advantages over previous lipid cubic phase (LCP) assays by being compatible with standard high-throughput liquid-handling platforms.

Assay Protocol:

  • Prepare recombinant PlsY in appropriate detergent micelles

  • Combine with G3P substrate and acyl donor

  • Monitor reaction progress through phosphate release using fluorescently labeled phosphate binding protein

  • Conduct assays at elevated temperatures (55-65°C) appropriate for A. aeolicus enzymes

  • Verify linear reaction velocity (up to 30 minutes with optimal enzyme loading)

Kinetic Analysis: Determine the Michaelis-Menten parameters (Km and Vmax) to ensure the recombinant enzyme displays expected kinetic behavior. PlsY should exhibit Michaelis-Menten kinetics with parameters in the range observed for other bacterial acyltransferases (Vmax of approximately 57.5 μmol min⁻¹ has been reported for related PlsY enzymes) .

What substrates should be used to characterize A. aeolicus PlsY specificity?

The substrate characterization of A. aeolicus PlsY should include both the glycerol-3-phosphate acceptor and various acyl donors to establish specificity profiles:

Glycerol-3-phosphate (G3P): As the primary acceptor substrate, pure G3P is essential for accurate kinetic measurements. The apparent Km for G3P in bacterial GPATs can vary substantially, with values ranging from approximately 90 μM to over 1000 μM depending on the bacterial species and experimental conditions .

Acyl donors: To establish acyl chain specificity, test the following:

  • Acyl-ACP derivatives with varying chain lengths (C8-C18)

  • Saturated vs. unsaturated acyl chains

  • Straight chain vs. branched chain acyl groups

Substrate preference testing reveals important insights into the enzyme's biological role and potential applications. Other bacterial GPATs have shown distinctive preferences; for example, stromal GPAT from sunflower demonstrates strong preference for oleic acid versus palmitic acid, with weak activity toward stearic acid . The substrate selectivity of A. aeolicus PlsY may reflect adaptations to its hyperthermophilic lifestyle.

A comprehensive substrate profiling approach should include:

  • Concentration-dependent activity measurements

  • Competition assays with mixed substrates

  • Temperature-dependent changes in substrate preference

What structural features of A. aeolicus PlsY contribute to its thermostability?

The thermostability of A. aeolicus PlsY, like other proteins from this hyperthermophilic organism, likely stems from several structural adaptations that differentiate it from mesophilic homologs:

Primary Sequence Adaptations:

  • Increased frequency of charged amino acids (particularly arginine and glutamic acid) that form salt bridges

  • Higher proportion of hydrophobic amino acids in the protein core

  • Reduced frequency of thermolabile residues (asparagine, glutamine, cysteine, and methionine)

  • Shorter surface loops that are less susceptible to thermal fluctuations

Structural Stabilization Mechanisms:

  • Enhanced electrostatic interactions through salt bridge networks

  • Increased hydrophobic packing in the protein core

  • Additional hydrogen bonding networks

  • Optimized secondary structure elements with more extensive helix capping

While the search results don't provide specific structural information for A. aeolicus PlsY, these features are typically observed in proteins from hyperthermophiles like A. aeolicus, which can grow at temperatures up to 95°C. The optimal activity temperature for A. aeolicus enzymes is generally around 55-65°C as observed with other enzymes from this organism .

Understanding these structural adaptations is crucial for protein engineering efforts and for interpreting crystallographic data when available.

How can I optimize the high-throughput screening assay for A. aeolicus PlsY inhibitors?

Developing an optimized high-throughput screening (HTS) assay for A. aeolicus PlsY inhibitors requires careful consideration of several parameters:

Assay Development:
A micelle-based assay system has significant advantages over lipid cubic phase (LCP) systems for high-throughput applications. The high viscosity of LCP makes it incompatible with common liquid-handling platforms, whereas hosting PlsY in detergent micelles enables assay performance using standard multi-channel pipets in a high-throughput manner .

Optimization Parameters:

ParameterOptimization RangeConsiderations
Enzyme Concentration0.1-10 μg/mLMust ensure linear reaction velocity up to 30 min
Temperature45-70°COptimal temperature for enzyme function (likely 55-65°C)
pH6.5-8.5Buffer compatibility with detection system
DetergentVarious non-ionic detergentsMust maintain enzyme stability without interfering with assay
G3P Concentration0.1-5 mMShould span Km values (90-1250 μM reported for bacterial GPATs)
Acyl Donor Concentration0.1-2 mMBased on preferred substrate
Detection MethodFluorescent phosphate sensorOptimize signal-to-noise ratio

Assay Validation:

  • Determine Z'-factor to assess assay quality (aim for Z' > 0.5)

  • Establish positive controls using known acyltransferase inhibitors

  • Implement counter-screening to identify false positives

  • Validate dose-response relationships for confirmed hits

When using the fluorescently labeled phosphate binding protein for detecting reaction progress, it's critical to account for potential fluorescence interference from compound libraries and to include appropriate background controls.

What are the major challenges in determining the crystal structure of A. aeolicus PlsY?

Crystallizing membrane proteins like A. aeolicus PlsY presents several significant challenges:

Membrane Protein-Specific Challenges:

  • Extracting PlsY from the membrane while maintaining its native conformation

  • Identifying suitable detergents or lipidic environments that stabilize the protein without interfering with crystal packing

  • Managing the hydrophobic surfaces that normally interact with the lipid bilayer

  • Overcoming conformational heterogeneity inherent to many membrane proteins

Thermophilic Enzyme Considerations:

  • Determining the optimal temperature range for crystallization trials (typically lower than physiological temperatures)

  • Accounting for potential temperature-dependent conformational changes

  • Selecting crystallization conditions compatible with thermostable proteins (often requiring higher ionic strength)

Technical Approaches to Address These Challenges:

ApproachMethodologyAdvantages
Detergent ScreeningSystematic testing of different detergent types and concentrationsIdentifies conditions that maintain protein stability and homogeneity
Lipidic Cubic PhaseCrystallization within a lipid-based mesophaseProvides membrane-like environment for protein stabilization
Protein EngineeringIntroduction of mutations that improve crystallizability or addition of fusion partnersCan enhance solubility and crystal contacts
Antibody Fragment ComplexesCo-crystallization with Fab fragments or nanobodiesIncreases hydrophilic surface area and rigidifies flexible regions
Lipid Nanodisc TechnologyIncorporation of PlsY into defined lipid nanodiscsMaintains native-like lipid environment while providing a homogeneous sample

Surface entropy reduction and the use of truncated constructs may also facilitate crystal formation by removing disordered regions that might hinder crystallization.

How does the mechanism of A. aeolicus PlsY compare with PlsY enzymes from mesophilic bacteria?

The catalytic mechanism of PlsY likely shares fundamental features across bacterial species while incorporating adaptations in A. aeolicus that enable function at elevated temperatures:

Conserved Mechanistic Features:

  • Two-substrate sequential mechanism involving binding of G3P and acyl donor

  • Acyl transfer to the sn-1 position of G3P

  • Release of products (lysophosphatidic acid and either CoA or ACP)

Thermophilic Adaptations in A. aeolicus PlsY:

  • Enhanced structural rigidity at key catalytic residues

  • Potentially altered substrate binding pocket dimensions to accommodate membrane fluidity changes at high temperatures

  • Modified electrostatic interactions at the active site

  • Possibly altered rate-limiting steps in the catalytic cycle

When comparing kinetic parameters, A. aeolicus PlsY likely exhibits:

  • Higher temperature optimum (55-65°C) compared to mesophilic enzymes

  • Greater thermostability but potentially lower activity at mesophilic temperatures

  • Potentially different substrate preferences reflecting the lipid composition of A. aeolicus membranes at high temperatures

Detailed kinetic analysis including measurement of activation energy (Ea), temperature dependence of Km and kcat, and the effects of viscosigens would provide valuable insights into the mechanistic adaptations of A. aeolicus PlsY.

What methods can be employed to study the oligomeric state of A. aeolicus PlsY in membrane environments?

Understanding the oligomeric state of membrane proteins like PlsY requires specialized approaches that can analyze proteins within or extracted from their native membrane environment:

Analytical Methods:

MethodApplicationInformation Obtained
Analytical UltracentrifugationDetergent-solubilized proteinSedimentation coefficient, molecular weight
Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS)Detergent-solubilized protein or protein in nanodiscsAbsolute molecular weight independent of shape
Blue Native PAGEDetergent-solubilized complexesApproximate molecular weight, complex stability
Chemical CrosslinkingIn-membrane or detergent-solubilized proteinProximity of subunits, interaction interfaces
Single-Particle Cryo-EMDetergent-solubilized protein or protein in nanodiscsStructural arrangement of oligomers
FRET AnalysisFluorescently labeled protein in membranes or reconstituted systemsSubunit proximity and dynamics

Experimental Considerations for Thermophilic Membrane Proteins:

  • Detergent selection is critical—some detergents may disrupt native oligomeric states

  • Temperature effects on oligomerization should be assessed (25°C vs. 55-65°C)

  • Lipid composition can influence oligomeric state and should be controlled

  • Sample stability during analysis must be monitored, especially for methods requiring extended time periods

For the most reliable results, combining multiple orthogonal techniques is recommended to verify findings across different experimental conditions.

How can the transcriptional regulation of plsY in A. aeolicus be studied?

Investigating the transcriptional regulation of the plsY gene in A. aeolicus presents unique challenges due to its hyperthermophilic nature but can be approached through several complementary strategies:

Promoter Analysis:

  • Identify putative promoter regions upstream of the plsY gene

  • Look for regulatory elements similar to those found in other bacterial acyltransferase genes

  • Compare with known transcriptional regulation mechanisms like the SREBP-1c-mediated regulation observed in eukaryotic GPAT genes

Experimental Approaches:

TechniqueApplicationInformation Gained
RT-qPCRRNA extracted from A. aeolicus under different growth conditionsQuantitative changes in plsY expression
RNA-SeqWhole transcriptome analysisGlobal gene expression patterns and co-regulated genes
Reporter Gene AssaysFusion of putative promoter regions to reporter genesPromoter activity under different conditions
Chromatin Immunoprecipitation (ChIP)Identification of DNA-protein interactionsTranscription factors that bind the plsY promoter
EMSA (Electrophoretic Mobility Shift Assay)In vitro DNA-protein binding analysisConfirmation of specific regulatory interactions

Challenges Specific to A. aeolicus:

  • High growth temperature requirements (optimal growth at 85-95°C)

  • Limited genetic manipulation tools for hyperthermophiles

  • Potential differences in transcriptional machinery compared to model organisms

Heterologous expression systems may be employed to study A. aeolicus plsY regulation, though results must be interpreted cautiously as regulatory mechanisms could differ significantly from the native context.

What detergents are most effective for solubilizing and stabilizing recombinant A. aeolicus PlsY?

The selection of appropriate detergents is critical for maintaining the structural integrity and enzymatic activity of membrane proteins like A. aeolicus PlsY:

Recommended Detergent Screening Strategy:

Detergent ClassExamplesConsiderations
Mild Non-ionicDDM, LMNG, OGGood initial choices that generally maintain protein activity
ZwitterionicLDAO, Fos-cholineMore aggressive solubilization but potential denaturation
Steroid-basedDigitonin, CHAPSOften preserve protein-protein interactions
Peptide-basedSMA copolymers, amphipolsExtract proteins with surrounding lipids

When working with A. aeolicus PlsY, detergent micelles have been shown to provide a suitable environment for enzymatic activity assessment, enabling high-throughput approaches that were not possible with lipid cubic phase methods . The optimal detergent concentration should be determined empirically, typically starting at 2-3× the critical micelle concentration (CMC).

Stability Assessment:
Monitor protein stability in different detergents using:

  • Size exclusion chromatography profiles

  • Thermal shift assays (differential scanning fluorimetry)

  • Activity retention over time

  • Circular dichroism spectroscopy

For thermal stability studies of A. aeolicus PlsY, measurements should be conducted at elevated temperatures (45-85°C) relevant to this thermophilic enzyme's native environment .

How can I determine the kinetic parameters for A. aeolicus PlsY with accuracy?

Accurate determination of kinetic parameters for A. aeolicus PlsY requires careful experimental design and data analysis:

Experimental Design Considerations:

  • Temperature Control: Maintain precise temperature regulation (preferably at 55-65°C based on optimal temperatures observed for other A. aeolicus enzymes)

  • Initial Velocity Conditions: Ensure measurements are made under initial velocity conditions where:

    • Less than 10% of substrate is consumed

    • Product formation is linear with time

    • Enzyme concentration is significantly lower than substrate concentration

  • Substrate Range: For Michaelis-Menten kinetics analysis, use substrate concentrations spanning at least 0.2× to 5× the Km value (consider the range of 90-1250 μM reported for bacterial GPATs)

Kinetic Analysis Methodology:

ParameterMethodNotes
Km and VmaxMichaelis-Menten non-linear regressionPreferred over linearization methods (e.g., Lineweaver-Burk)
kcatCalculate from Vmax and enzyme concentrationRequires accurate determination of active enzyme concentration
Substrate SpecificityCompare kcat/Km for different substratesHigher values indicate preferred substrates
Temperature EffectsMeasure parameters across temperature range (25-85°C)Calculate activation energy using Arrhenius plots
pH EffectsDetermine kinetic parameters at different pH valuesIdentify ionization states important for catalysis

Data Analysis Recommendations:

  • Use global fit approaches when analyzing multiple datasets

  • Apply statistical validation to parameter estimates (confidence intervals)

  • Consider enzyme kinetics software packages for complex models

  • Report both means and standard errors for all parameters

When reporting kinetic parameters, reference values should be compared to those obtained for other bacterial PlsY enzymes, such as the Vmax of approximately 57.5 μmol min⁻¹ noted for related systems .

What approaches can be used to study the effect of temperature on A. aeolicus PlsY structure and function?

As a protein from a hyperthermophilic organism, A. aeolicus PlsY requires specialized methods to study its temperature-dependent properties:

Structural Stability Assessment:

TechniqueTemperature RangeInformation Obtained
Circular Dichroism (CD)25-95°CSecondary structure changes with temperature
Differential Scanning Calorimetry (DSC)25-125°CThermal transition temperatures, enthalpy changes
Intrinsic Fluorescence25-95°CTertiary structure alterations and unfolding
Dynamic Light Scattering (DLS)25-90°CSize distribution changes, aggregation onset
Hydrogen-Deuterium Exchange MS25-85°CRegional stability differences and unfolding pathways

Functional Analysis Across Temperature Range:

  • Enzyme Activity Measurements:

    • Determine temperature optima and range (likely 55-65°C based on other A. aeolicus enzymes)

    • Measure activation energy (Ea) using Arrhenius plots

    • Assess irreversible inactivation kinetics at temperatures above optimum

  • Substrate Binding Studies:

    • Isothermal titration calorimetry at different temperatures

    • Surface plasmon resonance with temperature control

    • Fluorescence-based binding assays with temperature variation

  • Molecular Dynamics Simulations:

    • Compare protein flexibility at different temperatures

    • Identify temperature-sensitive regions and stabilizing interactions

    • Model water and detergent/lipid interactions at elevated temperatures

Comparative Analysis: Parallel studies with mesophilic homologs can highlight thermostability determinants unique to A. aeolicus PlsY. This approach can reveal structural features that may explain functional differences between thermophilic and mesophilic acyltransferases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.