Recombinant Aquifex aeolicus Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Aquifex aeolicus LspA

Recombinant Aquifex aeolicus LspA is a truncated, partially purified enzyme expressed in Escherichia coli. It retains catalytic activity and is widely used to study bacterial lipoprotein processing, antibiotic resistance mechanisms, and inhibitor development . As a membrane-bound enzyme, LspA is essential in Gram-negative bacteria, making it a promising target for novel antibiotics .

3.2. Functional Validation

Activity is validated using gel-shift assays tracking substrate processing (e.g., prepro inhibitor of cysteine protease, ppICP) . Inhibitor studies confirm specificity, with globomycin reducing PH mobility in EPR experiments .

Biochemical Properties

ParameterDetail
Molecular weightPartial sequence; full-length ≈25 kDa (predicted)
Optimal pHNot explicitly reported; inferred neutral (based on homologs)
ThermostabilityStable at high temperatures (consistent with Aquifex thermophily)
InhibitorsGlobomycin, myxovirescin (non-competitive binding)

5.1. Antibiotic Resistance Implications

  • β-lactam resistance: Staphylococcus aureus lspA mutants exhibit increased resistance to β-lactams, linked to altered cell envelope integrity .

  • Inhibitor design: Computational studies using A. aeolicus LspA homologs have guided cyclic peptide inhibitors (e.g., G2a, G2d) with nanomolar IC50 values .

5.2. Conformational Plasticity

  • Open state: Required for substrate entry, observed in MD simulations but not crystallography .

  • Closed state: Dominant in apo enzyme, protecting the polar active site from the hydrophobic membrane .

Applications in Drug Development

Recombinant A. aeolicus LspA facilitates:

  1. High-throughput screening for LspA inhibitors .

  2. Mechanistic studies of antibiotic resistance .

  3. Structural modeling of conformational states to guide rational drug design .

Limitations and Future Directions

  • Truncated form: Lack of full transmembrane domains limits understanding of membrane interactions .

  • Crystallography gaps: Apo and substrate-bound structures remain unresolved .

  • Thermophilic adaptation: Stability at high temperatures may complicate inhibitor translation to mesophilic pathogens .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your requests to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; lsp; aq_1837; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
lspA
Target Protein Sequence
MENFLRKTAWLYLSIAVSVFLLDIITKNLAEKLFTTHVEVFPFLEFYLIYNKGVAFGLLS ELPDPLRLPLLLITPVIALIITFLYALYSGDRIVAISMGLIGGGALGNLYDRLFLGMVRD FIHLHIGEYYWPAFNIADASISIGIALLILKYFFTKPALKNLVNRTR
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: aae:aq_1837

STRING: 224324.aq_1837

Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Aquifex aeolicus Lipoprotein signal peptidase (LspA) and what is its biological function?

Lipoprotein signal peptidase (LspA) from Aquifex aeolicus is an aspartyl protease integral to the lipoprotein-processing pathway in bacteria. Its primary function is to cleave the transmembrane helix signal peptide of lipoproteins after they have been modified by the addition of a diacylglyceryl moiety. This processing step is essential for the proper localization and function of lipoproteins in bacterial cell envelopes. LspA is a membrane-embedded enzyme with multiple transmembrane domains and a catalytic dyad of aspartic acid residues responsible for its proteolytic activity .

The significance of LspA derives from its essential role in Gram-negative bacteria and its importance for virulence in Gram-positive bacteria. The enzyme exhibits remarkable conformational flexibility, particularly in its periplasmic helix, which allows it to accommodate and process a variety of lipoprotein substrates with different sequences and structural properties .

What structural features of Aquifex aeolicus LspA are critical for its function?

The key structural features of Aquifex aeolicus LspA include:

  • Transmembrane domains: Multiple transmembrane regions anchor the enzyme within the bacterial membrane .

  • Catalytic dyad: A pair of aspartic acid residues forms the catalytic core essential for proteolytic activity .

  • Periplasmic helix (PH): This highly conserved helix exhibits significant conformational flexibility on the nanosecond timescale, playing a crucial role in substrate binding and catalysis .

  • β-cradle: This structural element works with the periplasmic helix to "clamp" substrates in place for proper positioning during proteolytic cleavage .

  • Active site: Surrounded by 14 highly conserved residues in addition to the catalytic dyad, highlighting the evolutionary importance of this region for enzymatic function .

These features collectively enable LspA to perform its essential function while also making it an attractive target for antibiotic development due to its high degree of conservation and essential role .

What expression systems and purification strategies are effective for producing recombinant Aquifex aeolicus LspA?

For the recombinant production of Aquifex aeolicus LspA, the following methodological approach has proven successful:

Expression System:

  • E. coli expression using the pET28b vector system with an N-terminal 6xHis tag and thrombin cleavage sequence .

Purification Protocol:

  • Transformation into appropriate E. coli expression hosts

  • Culture growth and protein expression induction

  • Cell harvest and membrane fraction isolation

  • Detergent-mediated membrane protein extraction

  • Nickel affinity chromatography using the N-terminal His-tag

  • Optional thrombin cleavage for tag removal

  • Size exclusion chromatography for final purification

Buffer and Detergent Considerations:

  • FC12 detergent micelles have been successfully used for maintaining LspA in a functional state during purification and subsequent studies .

  • Careful detergent selection is critical as inappropriate detergents (such as DMSO) can significantly impact protein conformation and experimental results .

For studies requiring site-specific labeling, cysteine residues can be introduced via PIPE Mutagenesis or QuikChange techniques, followed by specific labeling protocols appropriate for the intended analytical method .

Why is Aquifex aeolicus LspA considered a promising target for antibiotic development?

Aquifex aeolicus LspA represents an excellent target for antibiotic development for several compelling reasons:

  • Essentiality: LspA is essential for viability in Gram-negative bacteria, making it an attractive target for broad-spectrum antibiotics .

  • Virulence factor: In Gram-positive bacteria, while not essential for viability, LspA is important for virulence, making it a potential target for anti-virulence strategies .

  • Low resistance potential: The highly conserved active site of LspA suggests that resistance mutations would likely interfere with the enzyme's ability to bind and cleave its natural substrates. This characteristic indicates a lower potential for the development of antibiotic resistance .

  • Known inhibitors: Antibiotics such as globomycin and myxovirescin have been shown to inhibit LspA, providing valuable structural insights into inhibitory mechanisms .

  • Multiple conformational states: The enzyme exhibits different conformational states that can be targeted by inhibitors, offering various strategies for therapeutic intervention .

This combination of features makes LspA an attractive target for developing new antibiotics that may face reduced development of resistance compared to other targets.

How does the conformational dynamics of LspA affect its substrate processing?

The conformational dynamics of Aquifex aeolicus LspA are integral to its function in several key ways:

  • Dynamic equilibrium of states: LspA exists in at least three distinct conformational states:

    • Closed state: Predominant in the apo form, with the periplasmic helix occluding the active site

    • Intermediate state: Stabilized by antibiotic binding

    • Open state: Required for substrate binding and catalysis

  • Active site protection: In the apo (unbound) state, the dominant closed conformation occludes the charged active site from the hydrophobic lipid bilayer, protecting the polar catalytic residues when no substrate is present .

  • Nanosecond timescale fluctuations: The periplasmic helix fluctuates rapidly, sampling different conformations that facilitate substrate binding and processing .

  • β-cradle and PH clamping mechanism: In the most closed conformation, the β-cradle and periplasmic helix are only 6.2 Å apart, completely occluding the active site. This distance increases in the intermediate and open conformations, creating space for substrate entry and binding .

  • Substrate accommodation: The conformational flexibility allows LspA to process diverse lipoprotein substrates with different sequences and structures .

This dynamic behavior explains how LspA can accommodate various substrates and provides insights into potential mechanisms for inhibitor design targeting specific conformational states.

What methodologies are most effective for studying the conformational dynamics of Aquifex aeolicus LspA?

A hybrid experimental approach combining computational and spectroscopic methods has proven most effective for characterizing the conformational dynamics of Aquifex aeolicus LspA:

Molecular Dynamics (MD) Simulations:

  • Enable detailed analysis of protein movements on the nanosecond timescale

  • Can identify conformational states not captured in static crystal structures

  • Allow visualization of subtle changes in protein structure under different conditions

  • Provide insights into the energetics of conformational transitions

Electron Paramagnetic Resonance (EPR) Spectroscopy:

  • Continuous-wave (CW) EPR: Provides information about the mobility of specific regions within the protein

  • Double Electron-Electron Resonance (DEER): Measures distances between spin-labeled residues, allowing for determination of distinct conformational states

  • Requires site-directed mutagenesis to introduce cysteine residues at strategic positions for spin labeling

Experimental Workflow:

  • Generation of cysteine mutants at positions of interest using PIPE Mutagenesis or QuikChange

  • Expression and purification of mutant proteins with the N-terminal His-tag system

  • Site-specific spin labeling with nitroxide probes

  • CW-EPR measurements to assess local dynamics in FC12 detergent micelles

  • DEER measurements to determine distance distributions between labeled sites

  • MD simulations to interpret the experimental data and create a dynamic model

This combined approach has successfully identified conformational states of LspA not observed in crystal structures alone, demonstrating the value of integrative methodologies for membrane protein dynamics studies .

How do the conformational states of LspA differ between apo and antibiotic-bound conditions?

Comprehensive analysis using MD simulations and EPR spectroscopy has revealed significant differences in the conformational landscape of LspA between apo and antibiotic-bound states:

Apo State:

  • Dominant conformation: The closed state predominates, with the periplasmic helix positioned over the active site, occluding it from the membrane environment .

  • Distance metrics: The β-cradle and periplasmic helix are approximately 6.2 Å apart in the most closed conformation .

  • Conformational sampling: While the closed state dominates, the enzyme still samples other conformations at lower populations .

Globomycin-Bound State:

  • Multiple binding modes: DEER experiments reveal multiple distance populations, indicating several distinct conformational states .

  • Dominant conformation: Features a more open positioning of the periplasmic helix compared to the apo state .

  • Stabilization of intermediate state: Globomycin appears to stabilize an intermediate conformation between fully closed and fully open states .

Conformational Comparison Table:

FeatureApo StateGlobomycin-Bound State
Dominant PH conformationClosedMore open/intermediate
β-cradle to PH distance~6.2 Å (closed)Variable, intermediate distances predominate
Active site accessibilityOccludedPartially accessible
Conformational flexibilityHigh, ns timescaleReduced, stabilized by inhibitor
Substrate binding capabilityRequires transition to open stateInhibited

These conformational differences provide the structural basis for globomycin's inhibitory mechanism and offer insights for the design of new inhibitors targeting specific conformational states of LspA .

What are the challenges in crystallizing recombinant Aquifex aeolicus LspA and how can they be overcome?

Crystallizing membrane proteins like Aquifex aeolicus LspA presents several significant challenges, along with potential methodological solutions:

Major Challenges:

  • Conformational heterogeneity: LspA exhibits significant conformational flexibility, particularly in the periplasmic helix region, which samples multiple states on the nanosecond timescale. This heterogeneity impedes crystal formation, which typically requires a homogeneous protein population .

  • Membrane protein nature: As an integral membrane protein, LspA contains hydrophobic surfaces that require detergents for solubilization, which can interfere with crystal contacts .

  • Limited crystal contacts: Membrane proteins typically have limited hydrophilic surfaces available to form the necessary crystal contacts.

Strategic Solutions:

  • Conformational stabilization approaches:

    • Co-crystallization with antibiotics like globomycin that stabilize specific conformational states

    • Introduction of engineered disulfide bonds to restrict conformational flexibility

    • Crystallization in complex with antibody fragments or nanobodies that recognize and stabilize specific conformations

  • Crystallization environment optimization:

    • Systematic screening of different detergents and detergent concentrations

    • Utilization of lipidic cubic phase (LCP) crystallization, which provides a more native-like environment

    • Employment of bicelles or nanodiscs as alternative membrane mimetics

  • Protein engineering strategies:

    • Fusion with soluble proteins (e.g., T4 lysozyme) to increase hydrophilic surface area

    • Surface entropy reduction through mutation of high-entropy surface residues

    • Creation of minimal constructs eliminating flexible regions while maintaining core structure

The successful crystallization of LspA homologs from other organisms bound to antibiotics suggests that similar approaches could be applied to Aquifex aeolicus LspA, with a focus on stabilizing specific conformational states through inhibitor binding or protein engineering .

What techniques can be used to assess the interaction between recombinant Aquifex aeolicus LspA and potential inhibitors?

A comprehensive approach to studying LspA-inhibitor interactions combines structural, biophysical, and functional techniques:

Structural Analysis Methods:

  • X-ray crystallography for high-resolution structures of LspA-inhibitor complexes

  • Cryo-electron microscopy when crystallization proves challenging

  • NMR spectroscopy for studying dynamic aspects of inhibitor binding

Biophysical Interaction Analyses:

  • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters of binding

  • Surface Plasmon Resonance (SPR) for real-time binding kinetics

  • Microscale Thermophoresis (MST) for binding affinity measurements using minimal protein amounts

Conformational Dynamics Assessment:

  • Electron Paramagnetic Resonance (EPR) to determine how inhibitor binding alters protein conformation

  • Double Electron-Electron Resonance (DEER) to measure distance changes between spin-labeled residues upon inhibitor binding

  • Molecular Dynamics simulations to model inhibitor binding modes and resulting conformational changes

Functional Evaluation Approaches:

  • Enzymatic activity assays measuring inhibition of proteolytic activity

  • Competition assays with known inhibitors like globomycin

  • Bacterial growth inhibition assays to assess whole-cell activity

Experimental Protocol Considerations:

  • Expression and purification in E. coli using His-tag affinity purification

  • Reconstitution in appropriate detergent micelles (e.g., FC12) that maintain native structure

  • Verification of proper folding before inhibitor binding studies

  • Careful handling of inhibitors with consideration for solubility and stability issues

This multifaceted approach provides complementary data on inhibitor binding mode, affinity, kinetics, and functional consequences, enabling rational optimization of lead compounds for antibiotic development .

How can site-directed mutagenesis be used to investigate the catalytic mechanism of Aquifex aeolicus LspA?

Site-directed mutagenesis represents a powerful approach for dissecting the catalytic mechanism of Aquifex aeolicus LspA through systematic analysis of structure-function relationships:

Strategic Target Selection:

  • Catalytic dyad residues: Mutation of the aspartic acid residues comprising the catalytic dyad to assess their individual contributions to proteolytic activity .

  • Conserved active site residues: Targeting the 14 highly conserved residues surrounding the active site to determine their roles in substrate binding and catalysis .

  • Periplasmic helix residues: Mutating residues in the periplasmic helix to evaluate their importance in conformational dynamics and substrate clamping .

  • β-cradle residues: Investigating residues in the β-cradle structure that participate in substrate positioning .

Experimental Methodology:

  • Mutagenesis techniques: PIPE Mutagenesis and QuikChange have been successfully used for introducing mutations in Aquifex aeolicus LspA .

  • Expression and purification: Using the established pET28b vector system with N-terminal His-tag for affinity purification .

  • Functional assessment:

    • Activity assays measuring proteolytic activity against synthetic peptide substrates

    • Inhibitor sensitivity assays comparing wild-type and mutant proteins

    • Conformational analysis using EPR to determine how mutations affect protein dynamics

Data Analysis Framework:

  • Structure-function correlation, relating mutation effects to the structural context

  • Comparison with homologous enzymes to identify conserved mechanistic features

  • Integration with computational models to refine understanding of the catalytic mechanism

Sample Research Application:
For investigating the role of the periplasmic helix in substrate binding, a series of mutations could be introduced at conserved residues, followed by EPR analysis to determine how these mutations affect conformational dynamics and substrate binding. This approach has successfully identified the importance of the periplasmic helix in transitioning between closed and open states essential for substrate recognition and processing .

How does LspA recognize and accommodate diverse lipoprotein substrates?

LspA's ability to process various lipoprotein substrates with different sequences and structural properties stems from its remarkable conformational flexibility and adaptable active site architecture:

  • Conformational equilibrium: LspA exists in multiple conformational states, allowing it to adapt to different substrates. The periplasmic helix fluctuates on the nanosecond timescale, sampling conformations that can accommodate diverse substrates .

  • Clamping mechanism: The β-cradle and periplasmic helix form a dynamic clamp that can adjust to hold different substrates in the correct orientation for catalysis. This clamping mechanism varies from the most closed state (6.2 Å separation) to more open states that can accommodate the prolipoprotein substrate .

  • Active site plasticity: The active site of LspA demonstrates remarkable adaptability, as evidenced by its ability to bind different antibiotics (globomycin and myxovirescin) in various binding modes while maintaining similar interactions with the catalytic dyad .

  • Open conformation requirement: Molecular dynamics simulations have identified an open conformation that creates a trigonal cavity where the lipoprotein substrate can sterically fit in the active site. This open state appears to be essential for substrate binding but may be transiently populated and difficult to capture experimentally .

  • Conformational selection model: The experimental data suggests a conformational selection model where LspA samples all required conformational states (closed, intermediate, and open), with substrate binding shifting the equilibrium toward the catalytically competent open state .

Understanding these substrate recognition mechanisms is critical for designing inhibitors that can effectively compete with natural substrates while resisting development of resistance mutations.

What implications do the conformational dynamics of LspA have for rational drug design?

The conformational dynamics of LspA offer unique opportunities and challenges for rational drug design approaches:

Strategic Implications for Drug Design:

  • Targeting specific conformational states: Inhibitors can be designed to capture and stabilize particular conformational states of LspA. For example, globomycin stabilizes an intermediate conformation that prevents both substrate binding and catalysis .

  • Exploiting the conformational landscape: The existence of multiple conformational states provides opportunities for developing inhibitors with different binding modes and mechanisms of action .

  • Active site occlusion strategy: In the apo state, the periplasmic helix occludes the charged active site from the lipid bilayer. Inhibitors that prevent the transition to the open state could effectively block substrate access .

  • Resistance considerations: The highly conserved nature of the active site suggests that resistance mutations would likely interfere with essential enzyme function, reducing the probability of viable resistance development .

Methodological Implications:

  • Structure-based design approaches: Crystal structures of LspA homologs with bound antibiotics provide templates for structure-based design, but must be complemented with information about conformational dynamics .

  • Dynamic pharmacophore models: Rather than static models, pharmacophore hypotheses should account for the conformational flexibility of LspA to identify compounds that can bind preferentially to specific states .

  • Fragment-based approaches: The identification of small molecules that bind to different regions of LspA could lead to the development of inhibitors targeting specific conformational states.

  • Hybrid experimental-computational screening: Combining molecular dynamics simulations with experimental validation (e.g., EPR) provides a more complete picture of how potential inhibitors interact with the conformational ensemble of LspA .

By considering the conformational dynamics of LspA in drug design efforts, researchers can develop more effective inhibitors that specifically target this essential bacterial enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.