Recombinant Aquifex aeolicus Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Mechanistic Insights from Homologs

While direct structural data for Aquifex aeolicus YidC is limited, studies on E. coli YidC provide critical insights:

  • Membrane Insertase Activity: YidC facilitates Sec-independent insertion of single-spanning membrane proteins (e.g., Pf3 coat protein) by recognizing hydrophobic regions and catalyzing their integration into lipid bilayers .

  • Sec Synergy: For multi-pass transmembrane proteins, YidC collaborates with the Sec translocon (SecYEG) to ensure proper folding and lateral release of hydrophobic segments .

  • Chaperone Function: YidC stabilizes membrane protein complexes post-insertion, as observed in the biogenesis of LacY and MalF .

Evolutionary Context

Phylogenetic analyses suggest YidC and SecY share a common evolutionary origin, with YidC’s three-helix bundle forming a hydrophilic groove analogous to SecY’s translocation pore . The Aquifex aeolicus YidC homolog retains this ancestral structural motif, enabling substrate interaction at the membrane-lipid interface .

Research Applications

  • In vitro Reconstitution: Used to study YidC’s catalytic efficiency in proteoliposomes, enabling quantitative analysis of membrane protein insertion .

  • Structural Studies: The His-tagged recombinant protein aids in crystallographic or cryo-EM investigations of YidC’s substrate-binding groove .

  • Functional Assays: Assesses YidC’s role in folding periplasmic domains of membrane proteins, such as penicillin-binding proteins (PBPs) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; aq_175; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-502
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
yidC
Target Protein Sequence
MMDNDNQFWKRFLIFTILMFLFITAYELFYIYYVKPSQPQKTEKKEVVKKEEFKNVNLPQ LMLGTFREKQEYKNTKTVKLGIYSLELSEKGGKILRFIDQKYGFDLISKAERELKIFPLE IFTGNPDLDQKLNFGEYEIKEGKNSVELIHKELKVKKILSYKNGAIHLSVEGLKPPFWVF VGSPPDDEAFYTHVGPVLKINGEVVRLDVDDLKGINEFEGNIEFGGEESRYFFKGAKDYQ KHIVYKVKLGDKFVSLSTFLYDGEKTIYLGAKDYARLRELGLVDTLDWGTLKIIVKPLFL FLYWIYEHTGSWVLSILVLTFIVRIFLFPLGYKSVVSMQKLQELAPKMEKIKQKYKDDPV KMQEEMMKLYAETGFNPMAGCLPILLQIPIFFALYKVLIITVDLKVSSFLWIPSLADKDP YYILPVIMGLTMILQQKMTPSPDPKQALVGYITSVAFTLLFINFPAGLVLYWTLNNVFNI IQNYLIKEVLLKDKSKGGSKKK
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids in the folding of multispanning membrane proteins.
Database Links

KEGG: aae:aq_175

STRING: 224324.aq_175

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural architecture of Aquifex aeolicus YidC and how does it differ from other bacterial homologs?

A. aeolicus YidC belongs to the Oxa1 superfamily of membrane protein insertases. The core structure consists of a three-helix bundle interrupted by a helical hairpin. This helical hairpin is cytoplasmic and plays a crucial role in substrate delivery. The three-helix bundle forms a protein-conducting hydrophilic groove delimited by a conserved hydrophobic residue . As a prokaryotic member of the Oxa1 superfamily, A. aeolicus YidC shares structural similarity with the halves of SecY, suggesting an evolutionary relationship between these two protein transporters .

Unlike YidC proteins from mesophilic bacteria, A. aeolicus YidC has evolved structural adaptations for extreme thermostability, as A. aeolicus is a hyperthermophilic bacterium that flourishes in extremely hot marine habitats . These adaptations likely include increased hydrophobic core packing, additional salt bridges, and reduced flexible loops.

What is the functional role of YidC in membrane protein biogenesis?

YidC functions as a membrane protein insertase that facilitates the insertion, folding, and assembly of membrane proteins. It serves as a critical component in several pathways:

  • Independent insertase pathway: YidC can directly insert certain small membrane proteins without requiring the Sec translocon.

  • Sec-dependent pathway: YidC works cooperatively with the SecYEG translocon to facilitate the lateral release and folding of transmembrane segments.

  • Assembly factor: YidC assists in the oligomerization and proper assembly of multi-subunit membrane protein complexes.

The hydrophilic groove formed by YidC's three-helix bundle is essential for creating a protected environment where hydrophobic segments of substrate proteins can be shielded from the aqueous environment while being properly oriented for membrane insertion .

What expression systems are optimal for recombinant A. aeolicus YidC production?

For successful expression of recombinant A. aeolicus YidC, consider the following optimized approaches:

E. coli-based expression system:

  • Strain selection: Use a TAT deletion strain (ΔtatABCDΔtatE) like the CJMS2 strain derived from BL21(DE3) to prevent contamination with native E. coli TAT components during purification .

  • Codon optimization: The gene should be codon-optimized for E. coli expression, as demonstrated in studies with other A. aeolicus membrane proteins .

  • Expression vectors: Use inducible expression vectors with strong promoters (T7 or tac) and appropriate fusion tags (His6, FLAG, or Strep-tag II) to facilitate purification.

  • Expression conditions: Optimize induction at lower temperatures (16-20°C) for 16-20 hours to enhance proper folding.

  • Membrane fraction isolation: Use differential centrifugation to isolate membrane fractions containing the expressed protein.

This approach has been successfully employed for other A. aeolicus membrane proteins, including TatC, which was well-expressed and purified from the CJMS2 strain .

What detergents and purification strategies yield the highest quality of functional A. aeolicus YidC?

Based on successful approaches with other A. aeolicus membrane proteins:

Detergent screening and solubilization:

  • Initial screening: Test a panel of detergents including n-dodecyl-β-D-maltoside (DDM), n-decyl-β-D-maltoside (DM), lauryl maltose neopentyl glycol (LMNG), and di-heptanoyl phosphatidylcholine (DHPC).

  • Optimal choices: DDM and DHPC have shown successful results with other A. aeolicus membrane proteins .

  • Solubilization conditions: Use 1-2% detergent at 4°C for 1-2 hours with gentle agitation.

Purification protocol:

  • Affinity chromatography: Use immobilized metal affinity chromatography (IMAC) with Ni-NTA for His-tagged proteins.

  • Size exclusion chromatography: Further purify using gel filtration to obtain monodisperse protein preparations.

  • Quality assessment: Verify purity using SDS-PAGE and protein homogeneity by multi-angle laser light scattering coupled with size exclusion chromatography .

For A. aeolicus TatC, purified protein at 15 mg/ml in DDM has been successfully analyzed by multi-angle laser light scattering to determine the oligomeric state , suggesting similar approaches could work for YidC.

What crystallization strategies have been successful for thermophilic membrane proteins like A. aeolicus YidC?

Based on successful crystallization of other A. aeolicus membrane proteins:

Crystallization approach:

  • Surface entropy reduction: Generate mutants to reduce surface entropy. For example, with A. aeolicus TatC, the K40A, E41A mutations combined with C-terminal truncation improved crystal quality significantly .

  • Lipidic environment: Use lipidic cubic phase (LCP) or bicelles to maintain the native-like membrane environment.

  • Detergent selection: DHPC has been successful for crystallizing A. aeolicus TatC, yielding crystals that diffracted to 4.0Å resolution .

  • Fusion protein strategy: Consider creating fusion proteins with crystallization chaperones such as T4 lysozyme to provide crystal contacts. This approach was successful with A. aeolicus TatC in DDM detergent .

  • Crystal seeding: When different crystal morphologies appear, use selective seeding to propagate the higher-quality crystal form, as was done with A. aeolicus TatC .

Data collection considerations:
For thermophilic proteins, which often yield better diffraction at cryogenic temperatures, optimize cryoprotection conditions using glycerol, ethylene glycol, or sugars to prevent ice formation during flash-cooling.

How can molecular dynamics simulations enhance our understanding of A. aeolicus YidC function in the membrane?

Molecular dynamics (MD) simulations provide valuable insights into membrane protein function:

MD simulation protocol:

  • System preparation: Align the YidC structure in a model phosphatidylcholine lipid bilayer, similar to approaches used for A. aeolicus TatC .

  • Simulation parameters: Run full atomistic MD simulations for at least 50 ns with 1-2 fs time steps, taking snapshots every 5-10 ns for analysis.

  • Analysis approaches:

    • Monitor membrane deformation around the protein

    • Track water penetration into the hydrophilic groove

    • Analyze conformational changes in the cytoplasmic helical hairpin

    • Identify potential substrate binding sites through cavity analysis

Expected insights:
MD simulations of A. aeolicus TatC revealed destabilization of the membrane around its pocket , suggesting similar analysis of YidC could identify regions where the lipid bilayer is perturbed to facilitate substrate insertion. The simulations can also predict how the hydrophilic groove might accommodate transmembrane segments during insertion.

What in vitro assays can reliably measure the insertase activity of purified A. aeolicus YidC?

Several complementary approaches can be used to assess YidC insertase activity:

Proteoliposome-based assays:

  • Reconstitution: Incorporate purified YidC into liposomes composed of E. coli polar lipids or synthetic lipid mixtures at protein:lipid ratios of 1:100 to 1:200.

  • Substrate preparation: Use in vitro translated or chemically synthesized model substrates labeled with fluorophores or radioactive isotopes.

  • Insertion assay: Measure substrate insertion by protease protection assays, where properly inserted substrates show fragments protected from externally added proteases.

  • Quantification: Use fluorescence spectroscopy or autoradiography to quantify insertion efficiency.

Biophysical interaction assays:

  • Surface plasmon resonance (SPR): Immobilize YidC on sensor chips and measure binding kinetics with potential substrate peptides.

  • Microscale thermophoresis (MST): Determine binding affinities between fluorescently labeled YidC and various substrate proteins or peptides.

  • Förster resonance energy transfer (FRET): Monitor conformational changes during substrate interaction using strategically placed fluorophores on YidC and the substrate.

When interpreting results, it's important to consider that A. aeolicus YidC functions optimally at higher temperatures, consistent with its origin from a hyperthermophilic bacterium that flourishes in extremely hot environments .

How does temperature affect the structure and function of A. aeolicus YidC compared to mesophilic homologs?

A. aeolicus proteins exhibit remarkable thermostability, consistent with the organism's hyperthermophilic nature . For YidC specifically:

Temperature effects on structure:

  • Thermal stability assays: Differential scanning calorimetry (DSC) typically shows that A. aeolicus proteins maintain their folded state at temperatures exceeding 80°C, significantly higher than mesophilic counterparts.

  • Structural rigidity: Circular dichroism (CD) spectroscopy at varying temperatures can reveal temperature-dependent conformational changes.

  • Intrinsically disordered regions: Some A. aeolicus proteins exhibit temperature-dependent disorder-to-order transitions. For example, A. aeolicus FlgM protein shows temperature-dependent structural changes , which might also occur in certain regions of YidC.

Functional temperature optima:

  • Activity profiling: Measure insertase activity across a temperature range (20-95°C) using thermostable liposomes.

  • Kinetic parameters: Determine how substrate binding affinity (Km) and catalytic rate (kcat) change with temperature.

  • Comparative analysis: Compare these parameters with YidC from mesophilic organisms to identify thermoadaptive features.

The hyper-stable nature of A. aeolicus proteins makes its YidC an excellent model for studying thermostable membrane protein insertases, with potential applications in structural biology and biotechnology.

What evidence supports the evolutionary relationship between YidC and the SecY translocon?

Recent structural and bioinformatic analyses provide compelling evidence for an evolutionary relationship between YidC and SecY:

Structural homology evidence:

  • Fold similarities: The SecY halves and YidC share a conserved fold comprising a three-helix bundle interrupted by a helical hairpin .

  • Functional elements: In both transporters, the three-helix bundle forms a protein-conducting hydrophilic groove delimited by a conserved hydrophobic residue .

  • Hairpin orientation differences: In YidC, the helical hairpin is cytoplasmic and facilitates substrate delivery, whereas in SecY, it is transmembrane and forms the substrate-binding lateral gate helices .

Evolutionary model:
Based on these similarities, researchers propose that SecY originated from a YidC homolog through gene duplication and fusion. The progenitor YidC likely formed a channel by juxtaposing two hydrophilic grooves in an antiparallel homodimer . This model suggests that the fundamental protein transport machinery evolved from simpler insertases like YidC.

The conservation of key structural elements between these two essential membrane protein transporters highlights their shared evolutionary history and fundamental importance in all domains of life.

How has the YidC protein from A. aeolicus adapted to function in extreme thermophilic conditions?

A. aeolicus YidC exhibits several adaptations for functioning at high temperatures:

Thermostability features:

  • Amino acid composition: Likely enriched in charged residues (Arg, Glu) and reduced in thermolabile residues (Asn, Gln, Cys).

  • Structural rigidity: Contains additional salt bridges, hydrogen bonds, and tightly packed hydrophobic cores compared to mesophilic homologs.

  • Loop minimization: Shorter loops connecting secondary structure elements to reduce flexibility at high temperatures.

  • Surface charges: Optimized surface charge distribution to maintain solubility at elevated temperatures.

Membrane interaction adaptations:

  • Hydrophobic matching: Tailored hydrophobic thickness to match A. aeolicus membranes, which contain specialized lipids adapted for high temperatures.

  • Interfacial anchoring: Stronger interfacial interactions through aromatic and positively charged residues to maintain stable membrane association at extreme temperatures.

These adaptations allow A. aeolicus YidC to maintain structural integrity and function at temperatures where mesophilic proteins would denature. Similar thermostabilizing features have been observed in other A. aeolicus membrane proteins, including the sulfide:quinone oxidoreductase which was isolated from native membranes of this hyperthermophilic bacterium .

How can A. aeolicus YidC be used as a model system for studying membrane protein insertion mechanisms?

A. aeolicus YidC offers several advantages as a model system:

Research applications:

  • Structural determination advantages: The thermostability of A. aeolicus YidC makes it more amenable to crystallization and other structural biology techniques, similar to how A. aeolicus TatC was successfully crystallized for structural studies .

  • Conserved mechanism studies: The fundamental insertion mechanism is conserved across species, making insights from A. aeolicus YidC broadly applicable.

  • Thermostability benefits: Higher stability allows for experiments under harsh conditions that might denature mesophilic homologs, enabling novel experimental approaches.

Experimental approaches:

  • Site-directed crosslinking: Identify YidC-substrate contact points by introducing crosslinkable amino acids at strategic positions.

  • Single-molecule FRET: Monitor conformational changes during the insertion process with superior signal due to the protein's stability.

  • Electrophysiology: Study potential channel activity of YidC oligomers using planar lipid bilayers at varying temperatures.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map conformational dynamics and substrate interaction sites with enhanced signal due to protein stability.

The insights gained from A. aeolicus YidC can inform broader understanding of membrane protein biogenesis across all domains of life.

What are the current technical challenges in expressing and characterizing membrane proteins from hyperthermophiles like A. aeolicus?

Researchers face several technical challenges when working with A. aeolicus membrane proteins:

Expression challenges:

  • Codon usage discrepancy: Significant differences between A. aeolicus and common expression hosts require codon optimization. For multiple A. aeolicus membrane proteins, codon optimization for E. coli expression was necessary .

  • Membrane integration: Proper membrane insertion may require special signal recognition pathways. For example, the A. aeolicus F1F0 ATP synthase c-subunit contains an N-terminal signal peptide with signal recognition particle (SRP) recognition features that is obligatorily required for membrane insertion .

  • Temperature mismatch: Expression at lower temperatures in mesophilic hosts may affect folding pathways optimized for thermophilic conditions.

Characterization challenges:

  • Activity measurements: Standard assays may need to be adapted for higher temperature ranges. A. aeolicus proteins function optimally at elevated temperatures, consistent with the organism's growth in extremely hot marine habitats .

  • Detergent stability: Identifying detergents that maintain protein stability while facilitating structural and functional studies. For A. aeolicus TatC, both DDM and DHPC proved successful .

  • Lipid requirements: Determining optimal lipid compositions that mimic the native membrane environment of A. aeolicus.

Technical solutions:

  • Expression strain engineering: Use specialized strains like CJMS2 (ΔtatABCDΔtatE) to prevent contamination with host membrane proteins .

  • Fusion strategies: Engineer fusion constructs with stability-enhancing partners. For A. aeolicus TatC, a C-terminal lysozyme fusion improved protein behavior .

  • High-throughput screening: Systematically test multiple constructs, tags, and expression conditions to identify optimal parameters.

By addressing these challenges, researchers can leverage the unique properties of A. aeolicus membrane proteins for advancing our understanding of membrane protein biology under extreme conditions.

How does the substrate specificity of A. aeolicus YidC compare to YidC homologs from mesophilic bacteria?

The substrate specificity differences reflect adaptations to different cellular environments:

Comparative substrate analysis:

  • Conservation assessment: Core substrates (small membrane proteins with 1-2 transmembrane domains) are likely conserved across YidC homologs, reflecting the fundamental insertase function.

  • Thermophilic adaptations: A. aeolicus YidC likely evolved to handle substrates with thermostable features, including increased hydrophobicity and reduced flexibility in transmembrane regions.

  • Binding site characteristics: The hydrophilic groove that forms the substrate-binding site may have different electrostatic properties in A. aeolicus YidC compared to mesophilic homologs, reflecting adaptation to different membrane compositions.

Experimental approaches to determine specificity:

  • Competition assays: Use purified A. aeolicus YidC and mesophilic homologs to compare affinity for various model substrates.

  • Substrate profiling: Perform systematic analysis of substrate requirements using synthetic transmembrane peptide libraries with varying properties.

  • Chimeric proteins: Create hybrid YidC proteins with domains swapped between A. aeolicus and mesophilic sources to map specificity determinants.

These comparisons can reveal how substrate recognition mechanisms have evolved across diverse bacterial species and provide insights into the adaptation of membrane protein biogenesis machinery to extreme environments.

What insights can A. aeolicus YidC provide about the evolution of protein transport systems across domains of life?

A. aeolicus YidC represents an important evolutionary node in understanding membrane protein transporters:

Evolutionary significance:

  • Deep branching position: A. aeolicus belongs to one of the deepest branches in the bacterial phylogenetic tree, potentially preserving ancestral features of protein transporters.

  • Evolutionary link: Structural similarities between YidC and SecY suggest that SecY originated as a YidC homolog which formed a channel through antiparallel homodimerization .

  • Conservation across domains: YidC/Oxa1/Alb3 family members are present in all domains of life, indicating their fundamental importance in cellular evolution.

Comparative analysis approaches:

  • Structural comparison: Detailed comparison of A. aeolicus YidC with archaeal and eukaryotic homologs can reveal conserved functional elements.

  • Functional complementation: Test whether A. aeolicus YidC can functionally replace YidC homologs in diverse organisms to identify conserved functions.

  • Phylogenetic reconstruction: Use sequence and structural information to reconstruct the evolutionary history of protein transport systems.

This research direction contributes to our understanding of the origins of life and evolution, areas where A. aeolicus has already provided valuable insights , particularly regarding the development of essential cellular machinery like membrane protein insertion systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.