Recombinant Aquifex aeolicus NADH-quinone oxidoreductase subunit K 1 (nuoK1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant nuoK1

NuoK1 is a subunit of the NADH:quinone oxidoreductase (Complex I) in Aquifex aeolicus, a hyperthermophilic bacterium. Recombinant production involves heterologous expression in E. coli, with modifications such as N-terminal His-tagging for purification .

PropertyDetail
Uniprot IDO67339
Amino Acid Range1–100 (partial/full-length variants)
TagN-terminal 10×His-tag
Expression SystemE. coli (in vitro)
Molecular Weight~11 kDa (partial) / ~50 kDa (full-length)
Purity>85% (SDS-PAGE confirmed)
Storage-20°C or -80°C (lyophilized or liquid)

Role in Complex I

NuoK1 is part of the membrane arm of Complex I, which facilitates proton translocation during electron transfer from NADH to ubiquinone . In A. aeolicus, Complex I exists in two isoforms:

  • NQOR1: Active under low oxygen, with subunits NuoA₂, B, D₂, E, F, G, I₁, H₁, J₁, K₁, L₁, M₁, N₁ (total mass: 504.17 kDa).

  • NQOR2: Dominates under high oxygen, with subunits NuoA₁, B, D₁, E, F, G, H₂, I₂, J₁, K₁, L₂, M₂, N₂ (total mass: 523.99 kDa) .

Fe-S Clusters and Redox Properties

NuoK1 interacts with Fe-S clusters critical for electron transfer:

ClusterAssignmentMidpoint PotentialRole
N1aNuoB subunit-273 mVNADH oxidation
N2NuoI subunit-184 mVIntermediate electron transfer
N4NuoF subunitNot determinedQuinone binding site

These clusters enable sequential electron transfer from NADH to ubiquinone .

Isoform-Specific Activity

NQOR1 exhibits higher NADH:quinone oxidoreductase activity under low oxygen (7.5 ppm), while NQOR2 dominates in high-oxygen environments . This regulatory mechanism aligns with A. aeolicus’ adaptation to microaerophilic conditions.

Functional Interactions

NuoK1 interacts with hydrophilic subunits (e.g., NuoB, D₂) and membrane subunits (e.g., NuoH₁, J₁) to form a functional Complex I .

Research Uses

  • Biochemical Assays: NADH-quinone oxidoreductase activity measurements .

  • Structural Studies: Purification for crystallography or cryo-EM .

  • Immunoassays: ELISA detection of nuoK1 in bacterial extracts .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery timelines.
Note: Our standard shipping practice includes blue ice packs. If dry ice packaging is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag preference, please inform us, and we will prioritize your request.
Synonyms
nuoK1; aq_1319; NADH-quinone oxidoreductase subunit K 1; NADH dehydrogenase I subunit K 1; NDH-1 subunit K 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
nuoK1
Target Protein Sequence
MDIIKAYIILSIALFLIGLLGVIVRKNLITVLVSTELMLNGINLALVAADKVLGRVDGQI FAFFVLTVAAAEVAVGLGLIVAIFRLKGYEASHEISQLRD
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transport from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction with proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy in a proton gradient.
Database Links

KEGG: aae:aq_1319

STRING: 224324.aq_1319

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Aquifex aeolicus and why is it significant for studying extremophilic proteins?

Aquifex aeolicus is a hyperthermophilic, chemolithoautotrophic, and hydrogen-oxidizing bacterium isolated from a hydrothermal system at 102°C at Vulcano Island, Italy. This organism obtains energy for growth from inorganic compounds alone through unusual electron transfer pathways, making it an ideal model for studying protein adaptations to extreme environments . The extreme thermostability of its proteins, including respiratory chain components such as nuoK1, makes them valuable for understanding structural adaptations to high temperatures. These adaptations can provide insights into protein folding, stability mechanisms, and potential applications in biotechnology requiring thermostable components.

What is the function of NADH-quinone oxidoreductase subunit K 1 in the respiratory chain?

NADH-quinone oxidoreductase subunit K 1 (nuoK1), classified with EC number 1.6.99.5, functions as an integral membrane component of Complex I (NADH dehydrogenase I) in the respiratory electron transport chain of Aquifex aeolicus . The protein participates in electron transfer from NADH to quinones, contributing to the establishment of the proton gradient necessary for ATP synthesis. In the context of Aquifex aeolicus' unique bioenergetic properties, nuoK1 likely plays a crucial role in the organism's ability to thrive in extreme environments by maintaining efficient energy generation under high-temperature conditions where conventional respiratory proteins would denature.

How does recombinant nuoK1 differ from native nuoK1 in structural and functional properties?

Recombinant nuoK1 is produced in heterologous expression systems (typically yeast for commercial preparations) and represents a partial protein sequence of the native form . While maintaining key functional domains, recombinant nuoK1 may exhibit differences in post-translational modifications, quaternary structure interactions, and membrane integration compared to the native protein. These differences should be carefully considered when designing experiments. Purification methods involving detergent solubilization and the addition of stabilizing agents may be necessary to maintain proper folding and activity of the recombinant protein when removed from its native membrane environment.

What are the optimal conditions for assaying nuoK1 activity and how do they compare to the physiological conditions of Aquifex aeolicus?

The optimal conditions for assaying recombinant Aquifex aeolicus nuoK1 activity should approximate the extreme conditions of its native environment while accounting for practical laboratory constraints. Based on studies of other Aquifex aeolicus proteins, activity assays should be conducted at temperatures between 55-85°C . Buffer systems should maintain stability at high temperatures, typically using HEPES or phosphate buffers with pH 7.0-7.6 adjusted at assay temperature. Unlike mesophilic organisms, nuoK1 activity measurements require special considerations for thermal stability of reagents and equipment.

The table below summarizes recommended assay conditions compared to physiological conditions:

ParameterPhysiological ConditionsRecommended Assay Conditions
Temperature85-95°C55-85°C
pH~7.0-7.57.0-7.6
Salt concentrationHigh ionic strength100-300 mM NaCl
DetergentN/A (membrane-embedded)0.01-0.05% non-ionic detergent
Electron acceptorNative quinonesUbiquinone analogs or artificial electron acceptors

How can researchers distinguish between the activities of nuoK1 and other subunits in reconstituted NADH dehydrogenase complex systems?

Distinguishing the specific contribution of nuoK1 within the larger NADH dehydrogenase complex presents significant challenges requiring multifaceted approaches. First, conduct comparative activity assays using reconstituted complexes with and without nuoK1 to identify functional differences. Second, employ site-directed mutagenesis targeting conserved residues in nuoK1 to correlate structure-function relationships. Third, utilize crosslinking studies with labeled substrates or inhibitors to identify interaction sites specific to nuoK1. Fourth, develop nuoK1-specific antibodies for immunoprecipitation studies to isolate subcomplexes containing this subunit . Finally, consider complementation studies in model organisms with knockout mutations to confirm functional roles. The collective data from these approaches can differentiate nuoK1-specific activities from those of other subunits.

What are the key challenges in expressing and purifying functional recombinant nuoK1 and how can they be addressed?

Expression and purification of functional recombinant nuoK1 face numerous challenges stemming from its hyperthermophilic origin and membrane-associated nature. Heterologous expression often results in protein misfolding, aggregation, and low yields, as evidenced by studies of other Aquifex aeolicus proteins showing expression levels as low as 10 μg per liter of culture .

Key challenges and solutions include:

  • Codon optimization: Modify the N-terminal coding sequence to optimize translation in the host organism .

  • Expression system selection: Use thermophilic expression hosts or specialized strains designed for membrane proteins.

  • Solubilization strategies: Employ carefully selected detergents that maintain protein structure while effectively solubilizing membrane components.

  • Thermal stability: Incorporate stabilizing agents such as glycerol (5-50%) in storage buffers to prevent denaturation during purification .

  • Activity preservation: Minimize freeze-thaw cycles and store working aliquots at 4°C for short-term use (up to one week) .

What spectroscopic methods are most effective for characterizing electron transfer in purified nuoK1?

For characterizing electron transfer involving nuoK1, multiple complementary spectroscopic techniques should be employed. UV-visible spectroscopy can track changes in absorption spectra during redox reactions, particularly when coupled with stopped-flow apparatus for capturing rapid kinetics . Electron Paramagnetic Resonance (EPR) spectroscopy at liquid helium temperatures provides detailed information about paramagnetic centers involved in electron transfer, with measurements performed on both oxidized and reduced forms of the protein . Additionally, fluorescence spectroscopy can monitor conformational changes associated with electron transfer events when intrinsic or extrinsic fluorophores are strategically positioned.

The following methodological approach is recommended:

  • Record baseline UV-visible spectra (300-700 nm) of purified protein.

  • Add electron donors (NADH) and acceptors (quinone analogs) sequentially.

  • Monitor absorbance changes at specific wavelengths (typically 340 nm for NADH oxidation).

  • Prepare EPR samples of untreated and reduced forms using sodium dithionite (5 mM final concentration).

  • Conduct EPR measurements at various temperatures (4-77K) to capture different paramagnetic species.

How can researchers accurately measure the thermostability of nuoK1 and compare it with homologous proteins from mesophilic organisms?

Accurate thermostability measurements of nuoK1 require multiple complementary approaches. Differential Scanning Calorimetry (DSC) provides direct measurement of thermal transitions and unfolding events across a temperature range, typically 25-110°C for hyperthermophilic proteins. Circular Dichroism (CD) spectroscopy monitors secondary structure changes during thermal denaturation, with data collected at regular temperature intervals (5°C steps) from 25°C to 95°C.

Activity-based thermal stability assays compare residual activity after incubation at various temperatures, using standard enzyme assays conducted at a fixed temperature following thermal challenge. For comparative analysis with mesophilic homologs, identical experimental conditions must be maintained, recognizing that the mesophilic proteins will likely denature at much lower temperatures.

Thermostability analysis should include:

  • Determination of melting temperature (Tm) via DSC

  • Calculation of ΔG of unfolding at different temperatures

  • Measurement of half-life at various elevated temperatures

  • Comparison of activity profiles across temperature ranges

  • Assessment of refolding capacity after thermal denaturation

What are the optimal methods for investigating the integration of nuoK1 into membrane-bound respiratory supercomplexes?

Investigating nuoK1 integration into respiratory supercomplexes requires techniques that preserve native membrane protein interactions. Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE) followed by Western blotting with antibodies against nuoK1 or other supercomplex components provides visualization of intact complexes . Cryo-electron microscopy offers structural insights into supercomplex architecture and subunit positioning without requiring crystallization.

For functional studies, membrane reconstitution experiments using proteoliposomes can assess the activity of purified nuoK1 when integrated with partner proteins. Cross-linking mass spectrometry identifies specific interaction points between nuoK1 and neighboring subunits, helping map the three-dimensional arrangement within the supercomplex.

A comprehensive methodology includes:

  • Isolation of native membrane fractions under non-denaturing conditions

  • Gentle solubilization using mild detergents (digitonin or DDM)

  • Separation via BN-PAGE and identification via immunoblotting

  • Proteoliposome reconstitution with defined lipid compositions

  • Activity measurements of reconstituted systems compared to native membranes

How should researchers account for the unique properties of Aquifex aeolicus when interpreting nuoK1 functional data?

When interpreting functional data for nuoK1, researchers must consider Aquifex aeolicus' unique physiological context. This hyperthermophilic bacterium grows optimally at temperatures near 85°C and employs unusual electron transfer pathways from hydrogen sulfide (H₂S) to molecular oxygen or from hydrogen (H₂) to oxygen . These pathways may operate simultaneously in the cell, potentially affecting nuoK1 function in ways not observed in mesophilic systems.

Temperature effects must be carefully normalized, as reaction rates naturally increase with temperature following Arrhenius kinetics. Controls should include other thermostable enzymes to distinguish intrinsic temperature effects from adaptive features. Additionally, the organism's chemolithoautotrophic lifestyle means that nuoK1 functions in an energy metabolism derived entirely from inorganic compounds, potentially resulting in different electron flow patterns and regulatory mechanisms compared to heterotrophic bacteria . Finally, consider that Aquifex aeolicus has been proposed as one of the earliest diverging bacterial lineages, so evolutionary context may be necessary when comparing to other bacterial systems .

What statistical approaches are most appropriate for analyzing kinetic data from nuoK1 enzymatic assays?

The analysis of nuoK1 kinetic data requires statistical approaches that account for the complex nature of membrane-bound electron transfer reactions and the extreme conditions under which measurements are taken. Non-linear regression is essential for fitting data to appropriate enzyme kinetic models, typically using software packages like GraphPad Prism or R with specialized biochemical kinetics packages.

For temperature-dependent kinetics, Arrhenius plots (ln k versus 1/T) should be constructed to determine activation energies, with careful attention to potential deviations at extreme temperatures. Multiple replicates (minimum n=3) are necessary for all measurements, with outlier analysis performed using Grubbs' test or similar statistical methods. When comparing nuoK1 activity under different conditions or with various mutations, ANOVA with appropriate post-hoc tests (Tukey's HSD for multiple comparisons) should be employed rather than multiple t-tests to control for family-wise error rates.

For complex kinetic mechanisms involving multiple substrates, global fitting approaches that simultaneously analyze multiple datasets can provide more robust parameter estimates than individual curve fitting.

How can nuoK1 contribute to our understanding of electron transport chain evolution in early life forms?

The study of Aquifex aeolicus nuoK1 provides valuable insights into the evolution of bioenergetic systems in early life forms. Aquifex aeolicus is considered among the earliest diverging bacterial lineages based on 16S rRNA analysis, though this placement remains debated . The presence of functional NADH-quinone oxidoreductase complexes in this ancient-branching thermophile suggests that sophisticated electron transport mechanisms evolved very early in life's history.

Comparative genomic and structural analyses of nuoK1 across diverse bacterial, archaeal, and eukaryotic lineages can reveal conserved functional domains representing ancestral features of respiratory complexes. Unique structural adaptations in Aquifex aeolicus nuoK1 may reflect both thermophilic specialization and potentially ancestral characteristics. The unusual respiratory flexibility of Aquifex aeolicus, which can utilize multiple electron donors and acceptors through pathways involving sulfur compounds, hydrogen, and oxygen, may represent an evolutionary intermediate stage between anaerobic and aerobic energy metabolism .

Reconstructing the evolutionary trajectory of Complex I through careful analysis of nuoK1 and related subunits can illuminate how electron transport chains diversified from primitive redox systems to the sophisticated respiratory complexes observed in modern organisms.

What are the potential applications of nuoK1 structure-function insights for designing thermostable biocatalysts?

Understanding the structural basis for nuoK1's exceptional thermostability can inform the design of novel thermostable biocatalysts for industrial applications. Key thermostabilizing features likely include increased hydrophobic core packing, additional salt bridges, disulfide bonds, and reduced surface loop flexibility compared to mesophilic homologs. These principles can be applied to engineer thermostability into other industrially relevant enzymes.

The ability of nuoK1 to maintain functional electron transfer at extreme temperatures makes it a valuable model for designing robust redox catalysts for high-temperature bioelectrochemical applications, including biofuel cells and biosensors that must operate in harsh conditions. Structure-guided protein engineering approaches, including consensus design and ancestral sequence reconstruction based on nuoK1 and related proteins, can yield novel thermostable electron transfer components with tailored redox properties.

Additionally, understanding how nuoK1 maintains proper membrane integration and protein-protein interactions at high temperatures can inform the development of thermostable membrane protein scaffolds for synthetic biology applications requiring robust membrane-associated components.

What are the most common pitfalls in working with recombinant nuoK1 and how can they be avoided?

Researchers frequently encounter several challenges when working with recombinant nuoK1. Protein aggregation and inclusion body formation during expression represent major obstacles, particularly in mesophilic expression systems unaccustomed to producing thermophilic membrane proteins. This can be mitigated by using lower induction temperatures, specialized expression strains designed for membrane proteins, and fusion tags that enhance solubility.

Loss of activity during purification often occurs due to detergent-induced conformational changes or disruption of essential lipid interactions. Screening multiple detergents at various concentrations is essential, with milder detergents like digitonin or DDM often preserving more native-like structures. Adding lipids during purification can help maintain a more physiological environment.

Storage instability presents another challenge, as multiple freeze-thaw cycles can dramatically reduce activity. Aliquoting the purified protein and storing at -80°C with 50% glycerol as a cryoprotectant can help preserve function . For working stocks, storage at 4°C for up to one week is recommended over repeated freezing and thawing .

Finally, improper reconstitution methods can lead to incorrect membrane orientation or incomplete incorporation into liposomes. Optimizing lipid composition and carefully controlling the detergent removal rate during reconstitution can significantly improve functional incorporation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.