Recombinant Aquifex aeolicus NADH-quinone oxidoreductase subunit K 2 (nuoK2)

What is Aquifex aeolicus NADH-quinone oxidoreductase subunit K 2 (nuoK2) and what organism does it originate from?

NADH-quinone oxidoreductase subunit K 2 (nuoK2) is a protein component of the respiratory chain from Aquifex aeolicus, which is a chemolithoautotrophic, Gram-negative, hyperthermophilic bacterium. Aquifex aeolicus is considered one of the earliest diverging thermophilic bacterial species, growing optimally in water between 85°C and 95°C. The organism typically has a rod-shaped morphology with a length of 2.0-6.0μm and a diameter of 0.4-0.5μm . The nuoK2 protein is part of the NADH dehydrogenase complex (Complex I) which plays a critical role in the electron transport chain and energy conservation in this extremophile.

What are the basic structural characteristics of nuoK2?

The nuoK2 protein (UniProt accession: O67388) consists of 102 amino acids with the following sequence: MKTIPLEAFLTVSMILFGLGLIGIIARRNLVTVLMSLELALNAVNIALVGADHYLGLAEGQIFALFIIALAATEAAVGLGIIIAIFRLKKVESTDEIRELRG . Based on analysis of this sequence, nuoK2 exhibits typical characteristics of a membrane protein with multiple transmembrane domains, which is consistent with its role in the membrane-bound respiratory complex. The protein contains hydrophobic regions forming transmembrane helices that anchor it within the cytoplasmic membrane, where it participates in proton translocation and electron transfer activities.

How is recombinant nuoK2 typically expressed and purified for research purposes?

Recombinant nuoK2 is commonly expressed in E. coli expression systems, as indicated in the product specifications . The expression is typically conducted using standard bacterial expression vectors that enable high-level production of the protein. Due to nuoK2's membrane protein nature, specialized approaches such as detergent solubilization may be required during purification. The purification process often involves multiple chromatographic steps, potentially including affinity chromatography (if a tag is included in the recombinant construct), ion exchange chromatography, and size exclusion chromatography. The recombinant protein typically achieves a purity of >85% as determined by SDS-PAGE .

How does the thermostability of nuoK2 compare to homologous proteins from mesophilic organisms, and what structural features contribute to this thermostability?

Proteins from hyperthermophiles like Aquifex aeolicus, which grows optimally at 85-95°C, possess exceptional thermostability compared to their mesophilic counterparts . Though specific data on nuoK2's thermostability is not provided in the search results, proteins from A. aeolicus generally demonstrate remarkable thermal resistance. For example, the RNase P from A. aeolicus retains significant activity even after preincubation at 85°C, while the equivalent E. coli enzyme is essentially inactivated by the same treatment .

Structural features likely contributing to nuoK2's thermostability include:

• Increased number of ionic interactions

• Enhanced hydrophobic core packing

• Higher content of amino acids such as proline in loop regions

• Decreased number of thermolabile residues

• Potentially increased disulfide bonding

Researchers studying nuoK2 would benefit from comparative structural analysis with mesophilic homologs to identify the specific adaptations conferring thermostability, which could inform protein engineering approaches for enhanced thermal resistance in biotechnological applications.

How do post-translational modifications affect nuoK2 structure and function, particularly under extreme temperature conditions?

Post-translational modifications (PTMs) in extremophile proteins often play crucial roles in maintaining structural integrity and function under extreme conditions. For nuoK2, potential PTMs might include:

• Phosphorylation of serine, threonine, or tyrosine residues that could regulate enzyme activity

• Glycosylation that might enhance protein stability at high temperatures

• Methylation or acetylation that could influence protein-protein interactions within the NADH-quinone oxidoreductase complex

Research methodologies to investigate PTMs would involve mass spectrometry-based approaches comparing the native protein from A. aeolicus with recombinantly expressed versions. Differences in mass, fragmentation patterns, and chromatographic behavior would indicate the presence and nature of PTMs. Understanding these modifications would provide insights into adaptation mechanisms that enable protein functionality at the extreme temperatures where A. aeolicus thrives.

What are the optimal storage and handling conditions for recombinant nuoK2 to maintain its structural integrity and activity?

Based on the product specifications, the following guidelines are recommended for optimal storage and handling of recombinant nuoK2 :

For working solutions, it is advised to:

• Briefly centrifuge the vial before opening to bring contents to the bottom

• Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add 5-50% glycerol (final concentration) for long-term storage

• Store working aliquots at 4°C for up to one week

• Avoid repeated freezing and thawing cycles

What expression systems and conditions are most effective for producing functional recombinant nuoK2?

• Codon optimization for E. coli expression, especially considering the evolutionary distance between E. coli and A. aeolicus

• Selection of appropriate expression vectors with strong, inducible promoters (T7, tac, etc.)

• Expression temperature optimization—lower temperatures (15-25°C) may improve folding despite A. aeolicus being a thermophile

• Inclusion of chaperones to assist proper folding

• Consideration of membrane-protein specific expression strategies such as:

  • Use of C41(DE3) or C43(DE3) E. coli strains designed for membrane protein expression

  • Addition of membrane-stabilizing compounds in growth media

  • Testing of various detergents for optimal solubilization

For activity studies, it's essential to consider that nuoK2 functions as part of a multi-subunit complex, so co-expression with partner subunits might be necessary to assess its native functionality.

What analytical methods are most suitable for characterizing the structural integrity and functional properties of recombinant nuoK2?

A comprehensive characterization of recombinant nuoK2 would employ multiple complementary analytical techniques:

Structural Characterization:

• Circular Dichroism (CD) Spectroscopy: To assess secondary structure composition and thermal stability

• Fourier-Transform Infrared Spectroscopy (FTIR): For additional secondary structure information, especially useful for membrane proteins

• Nuclear Magnetic Resonance (NMR) Spectroscopy: For detailed structural analysis if protein size permits

• X-ray Crystallography or Cryo-EM: For high-resolution structural determination, particularly in complex with other subunits

Functional Characterization:

• Electron Transfer Activity Assays: Using artificial electron acceptors to monitor NADH oxidation

• Proton Translocation Assays: Using pH-sensitive fluorophores in reconstituted proteoliposomes

• Binding Assays: To assess interactions with other complex subunits or substrates

• Thermal Stability Assays: Differential scanning calorimetry or fluorimetry to quantify thermostability

Purity and Identity Verification:

• SDS-PAGE: For purity assessment (>85% as specified)

• Western Blotting: For specific detection using anti-nuoK2 antibodies

• Mass Spectrometry: For accurate mass determination and sequence verification

These methods together provide a comprehensive picture of the protein's structural integrity, functional capacity, and biochemical properties.

How does nuoK2 from Aquifex aeolicus compare structurally and functionally to homologous subunits in other bacterial and archaeal species?

Comparative analysis of nuoK2 across different species can provide valuable insights into evolutionary conservation and specialization. While the search results don't offer specific comparative data, general principles can be applied:

Key points for comparative analysis include:

• Sequence conservation analysis focusing on transmembrane domains and functional motifs

• Structural modeling to identify thermoadaptive modifications

• Functional comparisons with homologs from diverse thermal environments

• Evolutionary rate analysis to identify rapidly evolving vs. conserved regions

Such comparative studies would not only illuminate the evolutionary history of respiratory complexes but could also identify structural determinants of thermal adaptation relevant to protein engineering applications.

What insights can be gained from studying nuoK2 regarding the evolution of the respiratory chain in early-diverging bacterial lineages?

Aquifex aeolicus is considered one of the earliest diverging bacterial lineages , making its respiratory components particularly valuable for understanding the evolution of bioenergetic systems. The study of nuoK2 can provide several evolutionary insights:

• Ancient Respiratory Mechanisms: Analysis of nuoK2 sequence, structure, and function may reveal primitive features of the respiratory chain predating the divergence of major bacterial lineages

• Adaptation to Extreme Environments: As A. aeolicus is a hyperthermophile growing at 85-95°C , its nuoK2 can illustrate how early respiratory complexes adapted to extreme thermal conditions

• Horizontal Gene Transfer Assessment: Comparative genomics could reveal whether the nuoK2 gene shows evidence of horizontal gene transfer, similar to what was observed with the RNase P in A. aeolicus, which was acquired from Archaea

• Minimal Functional Requirements: A. aeolicus often contains streamlined versions of protein complexes, as evidenced by its minimal RNase P , suggesting nuoK2 might represent a minimal functional unit within the NADH-quinone oxidoreductase complex

Such evolutionary insights contribute to our understanding of the origins and diversification of bioenergetic systems that underpin all cellular life.

How can recombinant nuoK2 be utilized as a model system for studying thermostable membrane proteins and respiratory complexes?

Recombinant nuoK2 from A. aeolicus provides an excellent model system for studying thermostable membrane proteins due to several key attributes:

• Thermal Stability Benchmarking: The thermostability of A. aeolicus proteins, which function optimally at 85-95°C , makes nuoK2 a valuable reference for comparing and enhancing thermal properties of other membrane proteins

• Structural Rigidity Studies: The rigid structure required for high-temperature functionality allows researchers to explore principles of protein stability in membrane environments

• Crystallization Advantages: Thermostable proteins often exhibit enhanced crystallizability, potentially facilitating structural studies of membrane protein complexes

• Detergent Resistance: Thermostable membrane proteins typically show higher resistance to detergent denaturation, enabling more robust purification and reconstitution protocols

• Platform for Engineering: nuoK2 can serve as a scaffold for engineering novel properties into respiratory chain components, leveraging its inherent stability

Methodological approaches would include reconstitution into nanodiscs or liposomes, site-directed mutagenesis to identify stability determinants, and comparative structural biology to establish principles of thermoadaptation in membrane protein complexes.

What techniques are most effective for studying the integration of nuoK2 into functional respiratory complexes?

Studying the integration of nuoK2 into functional respiratory complexes requires specialized approaches for membrane protein assembly and interaction analysis:

• Co-expression Systems: Development of polycistronic expression constructs that produce multiple subunits of the NADH-quinone oxidoreductase complex simultaneously

• Membrane Mimetic Systems:

  • Nanodiscs for controlled incorporation of defined subunit combinations

  • Proteoliposomes for functional studies of proton translocation

  • Styrene maleic acid lipid particles (SMALPs) for extraction of intact membrane protein complexes

• Interaction Mapping Techniques:

  • Crosslinking mass spectrometry to identify subunit contact sites

  • Förster resonance energy transfer (FRET) to monitor proximity relationships

  • Blue native PAGE to analyze intact complex formation

  • Surface plasmon resonance to measure binding kinetics between subunits

• Functional Reconstitution Assays:

  • NADH:ubiquinone oxidoreductase activity measurements

  • Proton pumping efficiency determinations using pH-sensitive fluorophores

  • Patch-clamp electrophysiology for electron/proton transport analysis

These approaches would enable researchers to establish the structural and functional role of nuoK2 within the larger respiratory complex architecture.

What are common challenges in working with recombinant nuoK2 and how can they be addressed?

Researchers working with recombinant nuoK2 may encounter several challenges typical of membrane proteins, particularly those from extremophiles:

When transitioning from basic characterization to functional studies, reconstitution into appropriate membrane mimetics becomes crucial, as does consideration of the native complex partners that may be required for full functionality.

How can researchers validate the structural integrity and proper folding of recombinant nuoK2?

Validating the structural integrity and proper folding of recombinant nuoK2 requires multiple complementary approaches:

• Biophysical Characterization:

  • Circular dichroism spectroscopy to confirm secondary structure content

  • Tryptophan fluorescence spectroscopy to assess tertiary structure

  • Thermal denaturation profiles to verify expected thermostability

  • Size exclusion chromatography to evaluate monodispersity

• Functional Validation:

  • Lipid binding assays to confirm membrane protein characteristics

  • Partner subunit binding assays to verify interaction capabilities

  • Electron transfer activity when reconstituted with complex partners

  • Thermal stability assays confirming retention of structure at elevated temperatures

• Structural Analysis:

  • Limited proteolysis to probe for well-folded domains resistant to digestion

  • Hydrogen-deuterium exchange mass spectrometry to assess structural dynamics

  • Negative stain electron microscopy to evaluate particle homogeneity

• Comparative Benchmarking:

  • Comparison to native protein isolated from A. aeolicus when possible

  • Side-by-side analysis with nuoK2 expressed under different conditions

These validation approaches ensure that the recombinant protein maintains structural and functional properties representative of the native nuoK2 in A. aeolicus.

What are promising research avenues for further understanding the structure-function relationship of nuoK2 in bioenergetic systems?

Several promising research directions could advance our understanding of nuoK2's role in bioenergetic systems:

These research directions would contribute to fundamental understanding of extremophile bioenergetics while potentially yielding biotechnological innovations.

How might studies of nuoK2 contribute to our understanding of the adaptation of respiratory complexes to extreme environments?

Studies of nuoK2 from the hyperthermophile A. aeolicus can provide valuable insights into respiratory complex adaptation to extreme environments:

• Structural Determinants of Thermostability:

  • Identification of specific amino acid compositions and positions critical for high-temperature function

  • Analysis of membrane-protein interfaces under thermal stress

  • Characterization of lipid-protein interactions that maintain integrity at extreme temperatures

• Energetic Efficiency at Temperature Extremes:

  • Assessment of electron transfer and proton pumping efficiency at different temperatures

  • Comparison with mesophilic counterparts to identify thermoadaptive trade-offs

  • Investigation of kinetic parameters optimized for high-temperature catalysis

• Evolutionary Adaptation Mechanisms:

  • Comparative genomics across thermophiles, hyperthermophiles, and mesophiles

  • Analysis of selective pressures on respiratory complex genes

  • Identification of convergent adaptations in phylogenetically distant thermophiles

• Oxygen Tolerance Mechanisms:

  • Investigation of how A. aeolicus respiratory components maintain function in microaerobic conditions

  • Study of potential protective mechanisms against reactive oxygen species at high temperatures

These studies would expand our understanding of the molecular basis for extremophile adaptation and potentially inform the design of robust energy-converting systems for biotechnological applications in harsh environments.