Recombinant Aquifex aeolicus Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; aq_270; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
lgt
Target Protein Sequence
MFPEVISVFGLKISLYGILVALGVLVGYFLVLKLAKREGLNTKAVENTFMIAVLFGVIGA RIAYILEHPYEFHSLVDFLALWKGGVSFYGGLIGGIIGALIGIKVFNLPLWKSADIAAPA IALAHFFGRLGCTSAGCCYGKPFPYATSNEVGIHFSDKFPFFYVVFPKGAVAPPFTPLYP TQLMEAFGNLLIFFVLLFAYRYKPFSGFVFSLYLMLYGFERFFLEFFRGVTPPIPGIGLT WNQVVSLVLIAGSILLMFLLKNQKSNVVDYEV
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This reaction is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: aae:aq_270

STRING: 224324.aq_270

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Prolipoprotein diacylglyceryl transferase in Aquifex aeolicus?

Prolipoprotein diacylglyceryl transferase (lgt) from Aquifex aeolicus is an enzyme (EC 2.4.99.-) that catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine residue of prolipoproteins. This modification is the first step in the post-translational processing of bacterial lipoproteins, which are essential for various cellular functions including membrane integrity, nutrient acquisition, and cell signaling. In the hyperthermophilic bacterium Aquifex aeolicus, this enzyme functions optimally at extremely high temperatures, making it particularly interesting for thermostability studies and biotechnological applications requiring heat-resistant enzymes .

What expression systems are most effective for producing recombinant Aquifex aeolicus lgt?

The production of functional recombinant Aquifex aeolicus lgt presents several challenges due to its membrane-associated nature and the extreme thermophilic origin of the protein. Based on existing protocols, mammalian cell expression systems have proven effective for producing this protein with proper folding and post-translational modifications . E. coli-based expression systems can also be used, typically with an N-terminal polyhistidine tag to facilitate purification.

When expressing this protein, researchers should consider:

  • Codon optimization for the expression host to enhance translation efficiency

  • Use of strong inducible promoters (such as T7 or CMV)

  • Temperature optimization during induction phase (lower temperatures may improve solubility)

  • Addition of solubilizing agents or chaperones to improve folding

The expression of membrane proteins like lgt often results in inclusion body formation, which necessitates subsequent solubilization and refolding steps .

How can researchers optimize the purification process for Aquifex aeolicus lgt?

Due to the hydrophobic nature of Aquifex aeolicus lgt, purification presents significant challenges. The following methodological approach is recommended based on established protocols:

  • Initial solubilization: If the protein forms inclusion bodies, use 8.0 M urea for denaturation, as this approach has been successful with other Aquifex aeolicus proteins .

  • Affinity chromatography: Utilize metal-affinity chromatography with the His-tag for single-step isolation under denaturing conditions.

  • Refolding strategy: A key factor in obtaining active lgt is proper refolding. For related Aquifex aeolicus proteins, refolding in the presence of DNA has proven effective . For membrane proteins like lgt, refolding in the presence of detergents or lipid vesicles may enhance recovery of properly folded protein.

  • Quality control: Confirm protein purity using SDS-PAGE (target >85% purity) and verify proper folding through activity assays .

Table 1: Recommended Purification Protocol for Recombinant Aquifex aeolicus lgt

StepProcedureBuffer CompositionNotes
1Cell lysis50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1% Triton X-100, protease inhibitorsSonication or high-pressure homogenization
2Inclusion body isolationWashing with 2% Triton X-100, followed by 2M urea washMultiple washing steps recommended
3Solubilization8 M urea, 50 mM Tris-HCl pH 8.0, 500 mM NaCl, 5 mM imidazoleOvernight solubilization at room temperature
4IMAC purification8 M urea, 50 mM Tris-HCl pH 8.0, 500 mM NaCl, gradient of imidazole (5-500 mM)Under denaturing conditions
5RefoldingGradual dialysis against Tris-based buffer with decreasing urea concentration, with detergents (e.g., DDM)Perform at 4°C with stepwise reduction of urea
6Size exclusion50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% DDMFinal polishing step

What are the optimal storage conditions for maintaining Aquifex aeolicus lgt activity?

The stability and shelf life of Recombinant Aquifex aeolicus lgt depends significantly on storage conditions. Optimal storage recommendations include:

  • Short-term storage (up to one week): Store working aliquots at 4°C in an appropriate buffer system with stabilizing agents .

  • Medium-term storage (up to 6 months): Store in Tris-based buffer with 50% glycerol at -20°C. The high glycerol concentration prevents freeze-thaw damage to the protein structure .

  • Long-term storage (up to 12 months): Lyophilized preparations stored at -20°C or -80°C show the best stability for extended periods .

It is crucial to avoid repeated freeze-thaw cycles as these can significantly compromise protein integrity and activity. When preparing the protein for storage, aliquoting into single-use volumes is strongly recommended to prevent multiple freeze-thaw events .

What assay systems can be used to measure the enzymatic activity of Aquifex aeolicus lgt?

Measuring the enzymatic activity of Prolipoprotein diacylglyceryl transferase requires specialized assay systems due to its membrane-associated nature and the lipid substrates involved. Recommended methodological approaches include:

  • Radiolabeled lipid substrate assay: This classic approach uses 14C or 3H-labeled phosphatidylglycerol as the diacylglyceryl donor and a synthetic peptide containing the lipobox motif as the acceptor. After incubation, the lipidated peptide product is separated by thin-layer chromatography or extraction methods, and quantified by scintillation counting.

  • Fluorescence-based assays: FRET (Förster Resonance Energy Transfer) systems using fluorescently labeled substrate peptides that change emission properties upon lipid modification.

  • Mass spectrometry-based detection: LC-MS/MS can be used to directly quantify the conversion of substrate to product without the need for radioactive or fluorescent labels.

For thermostable enzymes like Aquifex aeolicus lgt, it's essential to conduct assays at elevated temperatures (typically 65-85°C) to observe optimal activity, while ensuring that all assay components remain stable under these conditions.

How can researchers effectively perform site-directed mutagenesis to study structure-function relationships in Aquifex aeolicus lgt?

Site-directed mutagenesis is a powerful approach for investigating the catalytic mechanism and substrate specificity of Aquifex aeolicus lgt. Based on approaches used for other Aquifex aeolicus enzymes, the following methodology is recommended:

  • Target selection: Identify conserved residues by multiple sequence alignment of lgt proteins across diverse bacterial species. Catalytic residues typically show the highest degree of conservation.

  • Primer design: Design mutagenic primers with the following characteristics:

    • 25-45 nucleotides in length

    • Desired mutation in the middle of the primer

    • GC content ≥40%

    • Tm ≥78°C

    • Terminate with one or more C or G bases

  • PCR conditions optimization: Due to the high GC content typical of Aquifex aeolicus genes, use DMSO (5-10%) or specialized GC-enhancing buffers to improve amplification efficiency.

  • Mutation verification: Confirm successful mutagenesis by sequencing before proceeding to protein expression.

  • Functional characterization: Compare the kinetic parameters (kcat, Km) of wild-type and mutant enzymes to determine the importance of specific residues.

This approach has been successfully applied to other Aquifex aeolicus enzymes, such as prephenate dehydrogenase, where mutations of key residues (His-147 and Arg-250) revealed their roles in catalysis and substrate binding .

How does the membrane integration of Aquifex aeolicus lgt affect its activity and substrate accessibility?

Prolipoprotein diacylglyceryl transferase (lgt) is an integral membrane protein with multiple transmembrane domains. Understanding its membrane topology is crucial for elucidating its catalytic mechanism and substrate interactions. Advanced biophysical studies suggest that:

  • The active site of lgt is likely positioned at the membrane-cytoplasm interface, allowing access to both the lipid substrate (phosphatidylglycerol) embedded in the membrane and the protein substrate (prolipoprotein) approaching from the cytoplasmic side.

  • The conserved transmembrane regions create a hydrophobic pocket that positions the active site residues for optimal catalysis.

  • The extreme thermophilic nature of Aquifex aeolicus adds complexity, as membrane fluidity and composition at high temperatures differ significantly from mesophilic conditions.

To experimentally investigate these aspects, researchers can employ:

  • Cysteine-scanning mutagenesis combined with accessibility studies

  • Fluorescence spectroscopy with environmentally sensitive probes

  • Reconstitution of purified lgt into lipid nanodiscs of varying composition

  • Molecular dynamics simulations to model protein-membrane interactions at high temperatures

These approaches can provide insights into how membrane integration influences the catalytic efficiency and substrate specificity of Aquifex aeolicus lgt under its native thermophilic conditions .

What structural adaptations enable Aquifex aeolicus lgt to function at extreme temperatures?

The thermostability of Aquifex aeolicus lgt is of particular interest for understanding protein adaptation to extreme environments. While the specific crystal structure of lgt from Aquifex aeolicus has not been determined, studies of other Aquifex aeolicus proteins provide insights into likely thermostabilizing features:

  • Electrostatic interactions: Increased number of salt bridges and charged networks that become stronger at elevated temperatures, as observed in other Aquifex aeolicus enzymes.

  • Hydrophobic core packing: More extensive and tightly packed hydrophobic core residues that resist thermal denaturation.

  • Secondary structure stabilization: Higher propensity for alpha-helical structures, particularly in membrane-spanning regions, providing rigidity at high temperatures.

  • Loop modifications: Shorter loop regions with higher proline content to reduce flexibility and entropy of the unfolded state.

  • Surface features: Reduced surface hydrophobicity and increased charged residues that maintain solubility at elevated temperatures.

Advanced structural biology techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) at various temperatures, differential scanning calorimetry (DSC), and circular dichroism (CD) spectroscopy can be employed to investigate these thermostabilizing features experimentally .

How has lateral gene transfer influenced the evolution of the lgt gene in Aquifex aeolicus?

Aquifex aeolicus has a complex evolutionary history characterized by extensive lateral gene transfer (LGT), which has significantly influenced its genome composition. Phylogenomic analyses reveal that:

  • The Aquificae bacterial group, including Aquifex aeolicus, shows gene affiliations to diverse lineages including Thermotogae, Proteobacteria (particularly Epsilonproteobacteria), and Archaea .

  • The phylogenetic position of Aquifex aeolicus remains debated, with evidence supporting both an early-branching position in the bacterial tree and a closer relationship to Epsilonproteobacteria.

Regarding the lgt gene specifically, comparative genomic analyses suggest that:

  • Core cellular functions (including membrane protein processing) show different evolutionary patterns than metabolic genes in Aquifex aeolicus.

  • While some core translational apparatus genes group Aquificae with Thermotogae, many metabolic and cellular process genes support links to Epsilonproteobacteria .

To investigate the evolutionary history of lgt specifically, researchers should:

  • Construct phylogenetic trees based on lgt sequences from diverse bacterial lineages

  • Analyze gene synteny and genomic context around the lgt locus

  • Examine codon usage patterns and GC content for evidence of horizontal acquisition

  • Conduct comparative analyses of enzyme substrate specificity across different bacterial phyla

These approaches can help determine whether the Aquifex aeolicus lgt gene was inherited vertically or acquired through lateral gene transfer, contributing to our understanding of bacterial evolution in extreme environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.