Recombinant Aquifex aeolicus Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
htpX; aq_1991; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-302
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
htpX
Target Protein Sequence
MSEREFLRFGDELDVKNCNTSRSFNGLLMAIGGIIGGTAGMLIALIIAGFMNFMSYWFSD KIVLSMYGAREIPYEEAPWLHQIVEELARRANMPKPKIYLVPMEQPNAFATGRGPGHAAV AVTRGILEILDQEELKGVLAHELAHIKNRDVLVATIAATIAGAIGFLANMAQWALFFGGL NRNEEEEGGGFAEMIGAILMIIIVPIIATIVQLAISRSREYFADETGAKICGCPVALARA LKKIEEYVMQVPANVNPGTAHLFIENPLKGGGIMELLSTHPSTEKRIQRLCELARKMGQE CI
Uniprot No.

Target Background

Database Links

KEGG: aae:aq_1991

STRING: 224324.aq_1991

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of HtpX protease in Aquifex aeolicus cellular metabolism?

HtpX in Aquifex aeolicus functions as an integral membrane (IM) metallopeptidase that plays a central role in protein quality control mechanisms. Similar to its Escherichia coli ortholog, it prevents the accumulation of misfolded proteins within the membrane environment, thereby maintaining membrane integrity under stress conditions . The enzyme is particularly important in hyperthermophilic organisms like A. aeolicus that face extreme temperature challenges, where protein stability is constantly threatened.

As a deep-branching hyperthermophilic chemoautotrophic bacterium restricted to hydrothermal vents and hot springs, A. aeolicus exhibits primitive metabolic characteristics that make its quality control machinery especially interesting from an evolutionary perspective . Unlike later-branching organisms where similar functions might be performed by fused proteins, A. aeolicus typically employs multi-subunit enzyme complexes, reflecting its position in early metabolic evolution . The HtpX protease represents an essential component of this primitive quality control system that has been conserved throughout bacterial evolution.

What structural features characterize HtpX from Aquifex aeolicus?

HtpX from Aquifex aeolicus is predicted to contain four transmembrane segments, with two positioned in the N-terminal region (within the first 55 residues) and two others in the central portion (approximately residues 150-215) . The characteristic HEXXH zinc-binding motif indicates that the catalytic moiety is positioned on the cytosolic side of the membrane, suggesting that the enzyme cleaves only cytoplasmic regions of membrane proteins .

The active site architecture includes two histidine residues (equivalent to H139 and H143 in E. coli HtpX) that coordinate the catalytic zinc ion, while a glutamic acid (equivalent to E140 in E. coli) likely functions as the general base and acid during catalysis by activating the water molecule that attacks the substrate . Additionally, a third zinc-coordinating residue, probably a glutamic acid, is predicted to be located within a "glutamate helix" spanning approximately 10 residues after the fourth transmembrane helix .

This architecture classifies HtpX as a member of the M48 family of metalloproteases with a conserved catalytic mechanism across various phylogenetic lineages, despite the thermophilic adaptations present in the A. aeolicus variant.

How does Aquifex aeolicus HtpX compare to orthologs from mesophilic organisms?

Typical thermophilic adaptations may include:

AdaptationMesophilic HtpX (e.g., E. coli)Thermophilic HtpX (A. aeolicus)
Amino acid compositionHigher glycine contentHigher proportion of charged residues
Salt bridgesFewer ionic interactionsIncreased number of salt bridges
Hydrophobic coreLess compactMore rigid, tightly packed hydrophobic core
Proline contentLower in loopsHigher in loops, reducing flexibility
Disulfide bondsFewerPotentially more for stabilization

These adaptations would enable the A. aeolicus HtpX to maintain structural integrity and catalytic function under the extreme temperature conditions of hydrothermal vents while preserving the fundamental proteolytic mechanism essential for membrane protein quality control .

What strategies can overcome self-cleavage issues during recombinant expression of Aquifex aeolicus HtpX?

Self-cleavage presents a significant challenge in recombinant expression of metalloproteases like HtpX. For the A. aeolicus ortholog, the following strategies can effectively address this issue:

ParameterConditions to TestExpected Impact
pH6.0-8.5Higher pH may reduce self-cleavage activity
Salt concentration100-500 mM NaClHigher salt may stabilize thermophilic proteins
Zinc chelatorsEDTA (0.1-1 mM)Controlled zinc availability may reduce activity
Glycerol10-30%May stabilize hydrophobic regions
Arginine/glutamate50-200 mMMay prevent aggregation and self-association

By implementing these strategies, researchers can significantly reduce self-cleavage while maintaining the structural integrity necessary for subsequent biochemical and structural studies .

How can structural studies of Aquifex aeolicus HtpX inform evolutionary understanding of metalloprotease mechanisms?

Structural studies of A. aeolicus HtpX provide a unique window into early evolutionary mechanisms of metalloproteases due to the organism's deep-branching position in bacterial phylogeny . Such studies can reveal:

  • Primitive catalytic architectures: As a representative of one of the earliest bacterial lineages, A. aeolicus HtpX likely exhibits a more primitive active site configuration compared to later-evolving organisms. Structural comparison with orthologs from mesophilic bacteria could reveal how metal coordination and substrate recognition have evolved over time .

  • Thermoadaptation mechanisms: Structural details can illuminate how metalloproteases adapted to extreme temperatures while preserving catalytic function. These adaptations might represent ancient solutions to protein stability challenges that were later modified in mesophilic lineages .

  • Modular enzyme organization: A. aeolicus tends to employ multi-subunit enzymes for metabolic functions that are catalyzed by fused proteins in later-branching organisms . Structural studies of HtpX might reveal whether this pattern extends to proteolytic systems and how subunit interfaces evolved.

  • Evolutionary pressure of thermodynamic efficiency: Evidence suggests that increasing thermodynamic efficiency was a major evolutionary driving force in early metabolic pathways . Structural analysis of HtpX could reveal whether similar pressures shaped protease evolution through optimized metal coordination, substrate binding, or catalytic mechanisms.

  • Membrane-protein interaction interfaces: The structure could provide insights into how primitive membrane proteases oriented within the lipid bilayer and how these interactions evolved as membrane composition changed throughout bacterial evolution .

By obtaining high-resolution structures of A. aeolicus HtpX, researchers can establish a baseline for understanding the fundamental principles of metalloprotease function that preceded the diversification of this enzyme family across bacterial lineages.

What experimental approaches can differentiate between substrate specificity mechanisms of Aquifex aeolicus HtpX and mesophilic orthologs?

Investigating substrate specificity differences between A. aeolicus HtpX and mesophilic orthologs requires sophisticated experimental approaches that account for both thermophilic conditions and membrane-associated proteolysis:

  • Comparative substrate profiling: Using synthetic peptide libraries containing systematic amino acid substitutions at positions P4-P4' around the cleavage site can reveal differential preferences between thermophilic and mesophilic orthologs. Results should be analyzed using quantitative cleavage efficiency measurements at both high (65-85°C) and moderate (37°C) temperatures .

  • Chimeric protein construction: Creating chimeric proteins that swap domains between A. aeolicus and mesophilic HtpX orthologs can identify regions responsible for substrate discrimination. Key constructs should include:

    • Cytoplasmic loop exchanges

    • Transmembrane segment swaps

    • C-terminal domain replacements

  • In vivo substrate identification using SILAC: Stable Isotope Labeling with Amino acids in Cell culture (SILAC) combined with mass spectrometry can identify differential substrate preferences by comparing proteomes of cells expressing either A. aeolicus or mesophilic HtpX variants under controlled conditions.

  • Molecular dynamics simulations: Computational analysis of substrate binding channels at different temperatures can reveal how thermal energy affects substrate recognition. Simulations should compare:

Simulation ParameterA. aeolicus HtpXMesophilic HtpX
Temperature range65-95°C25-45°C
Membrane fluidity modelHigh fluidityModerate fluidity
Substrate approach trajectoriesMultiple anglesMultiple angles
Water molecule behaviorHigh mobilityModerate mobility
Substrate residence timeCalculated at multiple tempsCalculated at multiple temps
  • Hydrogen-deuterium exchange mass spectrometry: This approach can reveal differential flexibility in substrate binding regions between thermophilic and mesophilic orthologs, potentially explaining substrate specificity differences resulting from conformational adaptation to temperature .

These approaches collectively can disentangle intrinsic substrate preferences from temperature-dependent effects, providing a comprehensive understanding of how substrate recognition evolved in this important protease family.

What expression systems yield optimal results for recombinant production of Aquifex aeolicus HtpX?

Optimizing expression systems for the hyperthermophilic A. aeolicus HtpX requires careful consideration of multiple factors. Based on experiences with related orthologs, the following approaches are recommended:

  • Host strain selection: E. coli BL21(DE3) has demonstrated superior performance for membrane protein expression compared to C43(DE3) and AD16 strains for HtpX orthologs . For the A. aeolicus protein specifically, consider using BL21(DE3) Rosetta to accommodate potential rare codon usage in this hyperthermophilic organism.

  • Vector selection: Modified pET-derived vectors with C-terminal affinity tags have shown excellent results. Specifically, a pET28 vector modified to attach a C-terminal octahistidine (His8)-tag without additional residues provides an optimal balance of expression and purification potential .

  • Fusion partner evaluation: Several fusion partners can dramatically improve expression levels of membrane proteins. The following table summarizes their effectiveness based on studies with HtpX:

Fusion PartnerExpression EnhancementSolubility ImpactTag SizeCleavage Requirements
Mistic~5×Significant improvement13 kDaFactor Xa
Thioredoxin2-3×Moderate improvement12 kDaTEV protease
GST2-3×Moderate improvement26 kDaPreScission protease
GB1Slight improvement6 kDaFactor Xa
ZtagMinimal effect7 kDaFactor Xa
No fusion1× (reference)StandardNoneNone
  • Growth and induction conditions: Optimal conditions include:

    • Growth medium: Terrific Broth (TB) supplemented with appropriate antibiotics

    • Growth temperature: 37°C until induction

    • Induction OD600: 0.8-1.0

    • IPTG concentration: 0.2-0.5 mM

    • Post-induction temperature: 18°C

    • Post-induction duration: 16-18 hours

  • Scale-up considerations: Initial expression screening should be conducted in 50ml cultures before scaling to 1-6L fermentations. For each liter of culture, expect approximately 5-8g of wet cell paste which should yield 1-2mg of purified A. aeolicus HtpX protein after optimization .

When implementing these recommendations, researchers should monitor expression levels via Western blotting using His-tag antibodies during optimization, as direct visualization on SDS-PAGE may be difficult due to the hydrophobic nature of the protein .

What purification strategies yield high-quality Aquifex aeolicus HtpX suitable for structural studies?

Purifying integral membrane proteins like A. aeolicus HtpX for structural studies requires specialized approaches. A comprehensive purification strategy includes:

  • Membrane extraction optimization: The critical first step involves properly solubilizing membranes containing the expressed protein:

    • Harvest cells and resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 500 mM NaCl, 10% glycerol

    • Lyse cells using a high-pressure homogenizer (15,000-20,000 psi, 2-3 passes)

    • Isolate membranes by ultracentrifugation (100,000×g, 1 hour)

    • Solubilize membranes with octyl-β-D-glucoside (1-2%) for 2 hours at 4°C with gentle agitation

  • Multi-step chromatography sequence: A three-step purification approach has proven effective:

Purification StepMethodBuffer CompositionGradient/ElutionExpected Yield
Initial captureIMAC (Co2+-affinity)50 mM Tris-HCl pH 8.0, 500 mM NaCl, 0.1% octyl-β-D-glucoside20-250 mM imidazole70-80% recovery
Intermediate purificationAnion exchange20 mM Tris-HCl pH 8.0, 100 mM NaCl, 0.1% octyl-β-D-glucoside100-500 mM NaCl60-70% recovery
PolishingSize exclusion20 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.1% octyl-β-D-glucosideIsocratic>95% purity
  • Detergent considerations: While octyl-β-D-glucoside has proven successful for E. coli HtpX, A. aeolicus proteins may benefit from detergents optimized for thermophilic membrane proteins. Consider screening:

    • Dodecyl-β-D-maltoside (DDM)

    • Lauryl maltose neopentyl glycol (LMNG)

    • n-Dodecylphosphocholine (DPC)

    • Optimizing detergent-to-protein ratio is crucial for maintaining protein stability

  • Stability enhancement during purification:

    • Add zinc chloride (10-50 μM) to all buffers to ensure proper metal coordination

    • Include glycerol (10%) throughout purification to stabilize hydrophobic regions

    • Consider adding lipids (0.01-0.05 mg/ml) to mimic native membrane environment

  • Quality assessment criteria:

    • Purity: >95% by SDS-PAGE and size exclusion chromatography

    • Monodispersity: Single symmetric peak by dynamic light scattering

    • Thermal stability: Differential scanning fluorimetry showing Tm >65°C

    • Protein identity: Confirmed by mass spectrometry and Western blotting

Using this approach, researchers can isolate homogeneous, stable, and properly folded A. aeolicus HtpX suitable for structural studies including X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy .

What activity assays can effectively characterize the proteolytic function of Aquifex aeolicus HtpX?

Developing effective activity assays for A. aeolicus HtpX requires consideration of its membrane-bound nature, hyperthermophilic origin, and putative role in protein quality control. The following assays are recommended:

  • Fluorogenic peptide substrate assays: Using peptides labeled with fluorescence resonance energy transfer (FRET) pairs allows quantitative measurement of proteolytic activity:

    • Design peptides based on known or predicted cleavage sites

    • Optimize buffer conditions for thermophilic activity (pH 7.0-8.5, 65-85°C)

    • Include proper controls: E140A mutant as negative control, commercial metalloproteases as positive control

    • Monitor activity in real-time using a temperature-controlled fluorescence plate reader

  • Membrane protein substrate degradation:

    • Express potential substrates (e.g., SecY, known misfolded membrane proteins) with detectable tags

    • Co-incubate with purified HtpX in detergent micelles or reconstituted proteoliposomes

    • Monitor degradation via Western blotting at various time points

    • Perform at temperatures ranging from 37-85°C to assess thermophilic preference

  • Thermostability-activity correlation analysis: This specialized assay can reveal how thermal adaptation affects proteolytic function:

Temperature (°C)Activity Measurement MethodExpected A. aeolicus HtpX BehaviorExpected E. coli HtpX Behavior
37Fluorogenic substrate cleavageMinimal activityOptimal activity
55Fluorogenic substrate cleavageModerate activityDeclining activity
70Fluorogenic substrate cleavageNear-optimal activityMinimal/No activity
85Fluorogenic substrate cleavageOptimal activityNo activity
  • Self-cleavage kinetics analysis: For wild-type HtpX (not the E140A mutant):

    • Purify the protein in the presence of EDTA to chelate zinc and prevent premature self-cleavage

    • Add zinc back to initiate self-cleavage

    • Monitor the process via SDS-PAGE and Western blotting at various time points and temperatures

    • Identify self-cleavage sites using mass spectrometry

  • Reconstituted proteoliposome activity assays:

    • Reconstitute purified HtpX into liposomes with compositions mimicking bacterial membranes

    • Compare activity against both soluble peptides and co-reconstituted membrane protein substrates

    • This approach more closely simulates the native environment of HtpX

These assays should be conducted with proper controls, including metal chelation controls (EDTA), specific metalloprotease inhibitors, and the catalytically inactive E140A mutant to confirm specificity of the observed proteolytic activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.