Recombinant Aquifex aeolicus Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

SecD is a core component of the SecDF complex in the Sec pathway, which facilitates post-translational translocation of proteins across bacterial membranes. In Aquifex aeolicus, SecD collaborates with SecF to utilize the proton motive force (pmf) to drive protein export, prevent substrate backsliding, and ensure efficient release of translocated proteins .

Mechanistic Insights

  • Role in Translocation: SecD-SecF stabilizes emerging preproteins at the periplasmic side of SecYEG, preventing backsliding. This process is pmf-dependent, with SecDF undergoing conformational shifts to "push" substrates outward .

  • Cryo-EM Studies: Structural analyses reveal that SecD’s periplasmic domain interacts dynamically with SecYEG, facilitating substrate handover during translocation .

  • Thermostability: Derived from Aquifex aeolicus, this SecD variant retains functionality at high temperatures, making it valuable for studying extremophile protein dynamics .

Functional Domains

  • TM Helices: Essential for membrane integration and pmf coupling.

  • Periplasmic Loops: Mediate substrate binding and ATPase regulation .

Applications in Research

  • Membrane Protein Studies: Used to reconstitute SecYEG-SecDF complexes for in vitro translocation assays .

  • Drug Discovery: Target for antibiotics disrupting bacterial protein secretion .

  • Structural Biology: NMR and cryo-EM templates for elucidating Sec machinery mechanics .

Comparative Analysis

OrganismSecD LengthKey FeatureReference
Aquifex aeolicus501 aaThermostable; pmf-dependent activity
E. coli571 aaWell-characterized in SecDF-YajC complex
Mycobacterium leprae571 aaPathogen-specific secretion adaptations

Future Directions

Current research gaps include:

  • Structural Dynamics: High-resolution tracking of SecD conformational changes during translocation.

  • Thermophile Adaptation: How Aquifex aeolicus SecD retains stability at extreme temperatures.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is defined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
secD; aq_973; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-501
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
secD
Target Protein Sequence
MILIMQKKNLWLHLLGLVILTLLSAYAVVKYPINLGLDLKGGVEFLLEPDFSVAIEREYE DLARNLREKLSKFNVLEVYATKEGVIIELLDKKEVENIKKVIQDINPNVIFEEEGDKLVV KFTQKYVEQLKEDIVRQSIEIIRDRIDKLGVTQPVVTRVGKYRILVDLPGFLDVERAKKI IGSTASLELKLVIDVSTDRKELEKKLTPDREILPSRDGREWFLVEKAPVITGQDLKTAYV GVDNLGQPAVNFELKGEAAEKFGKFTEQNIGKRLAIVLDRKVVSAPVIRSKISDRGQITG NFTAQEARDLALILRTGSLPSPLKFLQEKIVGPSLGKDAIEQGIKAGILAIILLAVVLIA RYKTAGITANISIFLNVLFLLASMAFLGATLTLPGIAGIILNMGIAVDSNVLIFERVKEE LRLGNTVSKAIELGFKRTLSAVWDTHVTLLVASVILFQFGSGPVKGFATTLALGTIASFI SNVYYAKVFLDLLNSLKILKI
Uniprot No.

Target Background

Function
SecD is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.
Database Links

KEGG: aae:aq_973

STRING: 224324.aq_973

Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Sec translocase system in A. aeolicus and how does SecD function within it?

The Sec translocase system in A. aeolicus, like in other bacteria, is responsible for the transport of unfolded proteins across the cytoplasmic membrane. The SecD subunit typically functions in conjunction with SecF as part of the SecDF complex, which associates with the core SecYEG translocon to enhance protein translocation efficiency. In A. aeolicus, this system has adapted to function optimally under extreme temperature conditions, making it uniquely interesting for studying protein translocation mechanisms in thermophiles.

The SecDF complex is thought to utilize the proton motive force to drive the later stages of protein translocation, particularly helping with the release of translocated proteins at the periplasmic side of the membrane. Based on related research with SecF, SecD likely contributes to maintaining the translocation-competent state of substrate proteins during their passage through the membrane .

How does the A. aeolicus SecD structure differ from mesophilic homologs?

A. aeolicus SecD, like other proteins from this hyperthermophilic organism, possesses structural adaptations that contribute to its thermostability. These typically include:

  • Increased number of salt bridges and hydrogen bonds

  • Higher proportion of charged amino acids on the surface

  • More compact folding with fewer flexible loops

  • Reduced number of thermolabile amino acids

  • Enhanced hydrophobic core packing

These structural features allow SecD to maintain its functional conformation at the extreme temperatures (up to 95°C) at which A. aeolicus thrives . Comparative structural analysis between A. aeolicus SecD and mesophilic homologs provides valuable insights into the molecular basis of protein thermostability.

What expression systems are suitable for recombinant production of A. aeolicus SecD?

Based on protocols used for similar proteins from A. aeolicus, E. coli expression systems are commonly employed for recombinant production of hyperthermophilic proteins. For SecD specifically:

  • E. coli Rosetta (DE3) strain is particularly suitable as it supplies tRNAs for rare codons that may be present in A. aeolicus genes .

  • The protein can be expressed with an N-terminal His-tag for purification purposes, similar to the approach used for SecF .

  • Expression should be conducted in LB medium supplemented with appropriate antibiotics.

  • Induction with IPTG at optimal concentration and temperature is critical for maximizing protein yield.

Expression protocols typically involve growth at 37°C until mid-log phase, followed by induction and continued growth for 3-4 hours or overnight at a reduced temperature (16-30°C) to enhance proper folding .

How can researchers investigate the interaction between A. aeolicus SecD and SecF proteins?

To investigate the SecD-SecF interaction in A. aeolicus, several complementary approaches can be employed:

Co-expression and co-purification strategy:

  • Design a bicistronic construct containing both secD and secF genes

  • Include different affinity tags on each protein (His-tag on SecD, alternative tag on SecF)

  • Perform tandem affinity purification to isolate the complex

  • Analyze the stoichiometry by SDS-PAGE and mass spectrometry

In vitro interaction studies:

  • Express and purify SecD and SecF separately

  • Perform pull-down assays using the affinity-tagged proteins

  • Analyze interactions by surface plasmon resonance or isothermal titration calorimetry

  • Conduct crosslinking experiments followed by mass spectrometry to identify interaction interfaces

Functional complementation tests:

  • Express A. aeolicus SecD in E. coli strains with secD mutations

  • Assess restoration of protein export function

  • Compare complementation efficiency with and without co-expression of A. aeolicus SecF

These approaches would provide insights into whether the A. aeolicus SecDF complex functions similarly to mesophilic counterparts despite adaptations to extreme temperatures .

What methods can be used to assess the thermostability of recombinant A. aeolicus SecD?

Given A. aeolicus' hyperthermophilic nature, characterizing the thermostability of its SecD protein is crucial. Several complementary methods can be employed:

Differential scanning calorimetry (DSC):

  • Measure heat capacity changes during protein unfolding

  • Determine melting temperature (Tm) and enthalpy of unfolding

  • Compare thermodynamic parameters with mesophilic SecD homologs

Circular dichroism (CD) spectroscopy:

  • Monitor secondary structure changes at increasing temperatures (25-100°C)

  • Plot thermal denaturation curves to determine Tm

  • Assess refolding efficiency after thermal cycles

Functional activity assays at different temperatures:

  • Develop an in vitro assay for SecD activity (e.g., ATP hydrolysis if applicable)

  • Measure activity at temperature intervals from 30-95°C

  • Determine temperature optimum and range for functional activity

Thermofluor assays:

  • Use fluorescent dyes that bind to hydrophobic regions exposed during unfolding

  • Monitor fluorescence changes during thermal ramping

  • Generate melting curves for high-throughput screening of stabilizing conditions

These methods would provide comprehensive characterization of SecD thermostability, offering insights into the molecular adaptations that enable function at extreme temperatures .

How does the SecD-dependent translocation pathway in A. aeolicus compare with the Twin-arginine Transport (Tat) pathway?

A. aeolicus possesses both Sec and Tat translocation systems, which serve distinct functions:

FeatureSec Pathway (SecD)Tat Pathway
Substrate stateUnfoldedFolded
Energy sourceATP hydrolysis and PMFPMF only
Signal peptideLess conserved, hydrophobic h-regionTwin-arginine motif
Cofactor accommodationNoYes
Subunit compositionSecYEG core, SecDF auxiliaryTatA, TatB, TatC
Oligomeric stateDynamicVariable, substrate-dependent
Thermostability in A. aeolicusHighHigh

The Tat pathway in A. aeolicus has been studied in relation to RNase P transport and function, demonstrating that A. aeolicus has acquired unique features in its protein transport systems through evolutionary adaptations and possibly horizontal gene transfer .

Researchers investigating SecD should consider potential overlap or complementarity between these pathways, particularly for substrates that might use both systems under different conditions in this extremophilic organism.

What are the key considerations for optimizing expression and purification of recombinant A. aeolicus SecD?

Optimizing expression and purification of A. aeolicus SecD requires addressing several challenges specific to membrane proteins from hyperthermophiles:

Expression optimization:

  • Codon optimization for E. coli expression

  • Testing multiple fusion tags (N-terminal vs. C-terminal His-tag)

  • Screening expression strains (BL21, Rosetta, C41/C43 for membrane proteins)

  • Optimizing induction conditions (IPTG concentration, temperature, duration)

  • Evaluating different promoter systems (T7, tac, arabinose-inducible)

Membrane protein extraction:

  • Selection of appropriate detergents (DDM, LDAO, etc.)

  • Detergent concentration optimization

  • Testing solubilization time and temperature

  • Evaluating different buffer compositions (pH, salt concentration)

Purification strategy:

  • Immobilized metal affinity chromatography (IMAC) using His-tag

  • Size exclusion chromatography for further purification

  • Ion exchange chromatography if needed

  • Potential use of thermostability assays to identify optimal buffer conditions

Protein quality assessment:

  • SDS-PAGE analysis

  • Western blotting

  • Mass spectrometry

  • Activity assays

  • Thermostability measurements

Following protocols similar to those used for other A. aeolicus membrane proteins would provide a starting point, with modifications specific to SecD based on its unique properties .

How can researchers design functional assays to evaluate A. aeolicus SecD activity?

Designing functional assays for A. aeolicus SecD requires consideration of its native role in protein translocation as well as the high-temperature environment where it naturally functions:

In vitro translocation assays:

  • Reconstitute purified SecD (ideally with SecF) into proteoliposomes

  • Prepare model substrate proteins with A. aeolicus Sec signal sequences

  • Measure translocation efficiency at various temperatures (37-95°C)

  • Assess ATP and proton motive force requirements

Complementation assays in heterologous hosts:

  • Express A. aeolicus SecD in E. coli secD mutants

  • Measure restoration of protein export function

  • Test temperature-dependent complementation efficiency

  • Evaluate effects of co-expressing A. aeolicus SecF

ATPase activity measurements (if applicable):

  • Develop a coupled enzyme assay to monitor ATP hydrolysis

  • Measure activity at different temperatures

  • Determine kinetic parameters (Km, Vmax)

  • Assess the effects of substrate proteins on ATPase activity

Protein-protein interaction assays:

  • Investigate SecD interaction with SecF and other Sec components

  • Use pull-down assays, surface plasmon resonance, or FRET

  • Determine binding affinities and thermodynamic parameters

  • Map interaction domains through mutagenesis

These assays would need to be performed under conditions that account for the thermophilic nature of A. aeolicus proteins, potentially requiring modifications to standard protocols used for mesophilic homologs .

How should researchers interpret structural data of A. aeolicus SecD in the context of its extreme thermophilic environment?

When analyzing structural data of A. aeolicus SecD:

  • Thermostability features analysis:

    • Identify and quantify salt bridges, hydrogen bonds, and disulfide bonds

    • Calculate surface charge distribution and compare to mesophilic homologs

    • Analyze amino acid composition, especially focusing on thermolabile residues

    • Evaluate structural compactness and flexibility regions

  • Structure-function correlation:

    • Map conserved functional domains and compare with mesophilic homologs

    • Identify structural adaptations that maintain function at high temperatures

    • Analyze membrane-interacting regions for thermophilic adaptations

    • Examine substrate binding sites and channel structures

  • Molecular dynamics simulations:

    • Perform simulations at different temperatures (37°C vs. 85-95°C)

    • Analyze protein stability and conformational changes

    • Compare flexibility and rigidity patterns between thermophilic and mesophilic SecD

    • Identify temperature-dependent conformational states

  • Evolutionary context interpretation:

    • Place structural features in the context of A. aeolicus' early-branching phylogenetic position

    • Compare with homologs from other thermophiles and mesophiles

    • Identify potential horizontal gene transfer signatures

    • Analyze co-evolution patterns with SecF and other interacting partners

These analyses would provide insights into how A. aeolicus SecD has adapted structurally to function in extreme conditions while maintaining its essential role in protein translocation .

What are the challenges in analyzing protein-protein interactions involving A. aeolicus SecD, and how can they be addressed?

Analyzing protein-protein interactions (PPIs) involving A. aeolicus SecD presents several challenges:

Thermostability challenges:

  • Many standard PPI techniques are optimized for mesophilic temperatures

  • Interactions may differ at physiological temperatures (85-95°C) vs. experimental conditions

  • Solution: Develop modified protocols that can work at elevated temperatures or extrapolate results from lower temperature experiments

Membrane protein complexities:

  • SecD is a membrane protein, complicating traditional interaction assays

  • Detergent micelles can interfere with interaction measurements

  • Solution: Use nanodisc or liposome reconstitution to provide native-like membrane environment

Transient interaction detection:

  • Some Sec pathway interactions are dynamic and transient

  • Traditional co-immunoprecipitation may miss key interactions

  • Solution: Employ crosslinking approaches with mass spectrometry to capture transient interactions

Data interpretation framework:

  • Distinguish direct from indirect interactions

  • Account for potential artifacts from heterologous expression

  • Solution: Use multiple complementary techniques and controls

Recommended experimental approach table:

ChallengeTechniqueAdaptation for A. aeolicus
Membrane environmentNanodiscs/ProteoliposomesUse thermostable lipids
Transient interactionsCrosslinking-MSHeat-stable crosslinkers
In vivo validationBacterial two-hybridThermophilic host if possible
Interaction affinityITC/SPRModified for higher temperatures
Structural validationCryo-EMSample preparation at higher temperatures

By addressing these challenges methodically, researchers can generate reliable data on SecD interactions that reflect its native behavior in A. aeolicus .

How can researchers employ comparative genomics to understand the evolution of SecD in A. aeolicus?

Comparative genomics approaches provide valuable insights into the evolution and adaptation of SecD in A. aeolicus:

  • Phylogenetic analysis:

    • Construct phylogenetic trees of SecD sequences from diverse bacteria

    • Compare with 16S rRNA phylogeny to identify potential horizontal gene transfer events

    • Analyze SecD evolution in context of Aquificae's early-branching position

    • Determine if SecD evolution mirrors that of other Sec components

  • Synteny analysis:

    • Examine the genomic context of secD in A. aeolicus

    • Compare with arrangement in other bacteria

    • Identify co-evolving gene clusters

    • Assess conservation of secD-secF genomic proximity

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify sites under positive or purifying selection

    • Compare evolutionary rates between thermophilic and mesophilic lineages

    • Identify residues under thermal adaptation pressure

  • Domain architecture comparison:

    • Analyze domain organization across bacterial phyla

    • Identify thermophile-specific domains or motifs

    • Map functional domains to understand evolutionary constraints

What biophysical techniques are most informative for characterizing the thermostability mechanisms of A. aeolicus SecD?

Several biophysical techniques are particularly informative for investigating thermostability mechanisms in A. aeolicus SecD:

High-resolution structural techniques:

  • X-ray crystallography: Provides atomic-level structural details

  • Cryo-electron microscopy: Especially useful for membrane protein complexes

  • NMR spectroscopy: For dynamics studies of specific domains

Thermal stability assessment:

  • Differential scanning calorimetry (DSC): Quantifies thermodynamic parameters of unfolding

  • Circular dichroism (CD) spectroscopy: Monitors secondary structure changes with temperature

  • Intrinsic fluorescence spectroscopy: Tracks tertiary structure stability

Molecular dynamics:

  • Temperature-replica exchange simulations: To sample conformational space at different temperatures

  • Steered molecular dynamics: To investigate mechanical stability

  • Free energy calculations: To quantify stabilizing interactions

Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Maps protein flexibility and solvent accessibility

  • Identifies regions with differential stability

  • Monitors temperature-dependent conformational changes

Experimental approach comparison:

TechniqueInformation obtainedAdvantages for A. aeolicus SecD
X-ray crystallographyAtomic structureIdentifies stabilizing interactions
DSCThermodynamic parametersQuantifies stability enhancement
HDX-MSRegional flexibilityMaps stability differences across protein
MD simulationsDynamic behaviorExamines behavior at physiological temperature
CD spectroscopySecondary structure stabilityMonitors unfolding transitions

Combining these approaches would provide comprehensive understanding of the molecular mechanisms underlying the remarkable thermostability of A. aeolicus SecD, which allows it to function at temperatures approaching 95°C .

How might understanding A. aeolicus SecD contribute to engineering thermostable protein secretion systems?

Understanding A. aeolicus SecD has significant implications for protein engineering applications:

  • Design of thermostable secretion hosts:

    • Engineering existing expression systems with A. aeolicus Sec components

    • Creating high-temperature protein secretion platforms

    • Developing heat-resistant cell factories for industrial enzymes

  • Protein thermostabilization principles:

    • Identifying key stabilizing interactions from A. aeolicus SecD

    • Applying these principles to thermostabilize other membrane proteins

    • Creating design rules for enhancing protein thermostability

  • Chimeric translocase systems:

    • Engineering hybrid secretion systems combining thermostable components with efficient mesophilic components

    • Creating systems with broader temperature operating ranges

    • Developing specialized secretion systems for thermophilic industrial applications

  • Biotechnological applications:

    • High-temperature protein expression systems

    • Thermostable protein secretion for industrial applications

    • Enhanced export of difficult-to-secrete proteins

Similar to how A. aeolicus motility proteins have been functionally characterized by expression in E. coli systems , SecD components could be utilized to enhance protein secretion at elevated temperatures or to improve the stability of secretion systems under harsh conditions.

What are the most promising directions for future research on A. aeolicus SecD?

Several promising research directions could significantly advance our understanding of A. aeolicus SecD:

  • Structural biology approaches:

    • High-resolution structure determination of A. aeolicus SecDF complex

    • Cryo-EM studies of the complete Sec translocon including SecD

    • Structural comparison with mesophilic homologs at atomic resolution

  • Functional characterization:

    • Detailed investigation of the role of SecD in the unique physiology of A. aeolicus

    • Comparison of substrate specificities between A. aeolicus and mesophilic SecD

    • Analysis of temperature-dependent functional changes

  • Systems biology approaches:

    • Comprehensive mapping of the A. aeolicus protein secretion network

    • Identification of all SecD-dependent exported proteins

    • Integration with other cellular processes in this extremophile

  • Evolutionary studies:

    • Investigation of horizontal gene transfer events in the evolution of A. aeolicus Sec system

    • Comparative analysis with other early-branching bacterial lineages

    • Reconstruction of ancestral Sec components

  • Applied research:

    • Development of A. aeolicus-based thermostable protein secretion systems

    • Engineering SecD variants with enhanced properties

    • Creation of chimeric secretion systems with novel properties

These research directions would build upon the findings that A. aeolicus represents one of the earliest diverging bacterial lineages and has acquired unique adaptations for protein transport systems, potentially involving horizontal gene transfer from archaea as observed with its RNase P system .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.