Recombinant Aquifex aeolicus Putative zinc metalloprotease aq_1964 (aq_1964)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize its inclusion.
Synonyms
aq_1964; Putative zinc metalloprotease aq_1964
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-429
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
aq_1964
Target Protein Sequence
MGLIAFLILIGVLVWVHEFGHFLMAKLFRVKVEIFSIGFGPPIFRRQWGETVYQIAALPL GGYVKLYGEEENVHDPRAFSTKKPWQKILIALGGPLFNFLFTILVFALVYTAGVEVPKYL KEPVVVGYVQRDSIAQKIGIKPGDKIIKINGYEVRTWEDLRDALIRLSLDGVKETTLFLE RNGEVLHLTIKVPNVQKGEELGIAPLVKPVVGGVKKGSPADQVGIKPGDLILEVNGKKIN TWYELVEEVRKSQGKAIKLKILRNGKMIEKELIPAKDPKTGTYFIGLFPKTETVVEKKPF GEALASAVNRTWELTVLTLKTIAGLITGKVSFQTLGGPIAIAQIAGQAAQSGFIPYLVMM AFISLQLGIFNLIPLPILDGGLILLFAIEWLRGRPLPEKFKEYWQRVGLAIIITLTIFVF INDILRLLR
Uniprot No.

Target Background

Database Links

KEGG: aae:aq_1964

STRING: 224324.aq_1964

Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Aquifex aeolicus putative zinc metalloprotease aq_1964?

Aquifex aeolicus putative zinc metalloprotease aq_1964 is a protein encoded by the aq_1964 gene in the hyperthermophilic bacterium Aquifex aeolicus. This enzyme belongs to the zinc metalloprotease family, which typically contains zinc in their active sites and catalyzes the hydrolysis of peptide bonds. Zinc metalloproteases from A. aeolicus are of particular interest because they originate from one of the earliest diverging thermophilic bacterial lineages, making them valuable for studying primordial enzyme functions and extreme temperature adaptations. The protein likely shares structural similarities with other zinc-binding metalloproteases, potentially exhibiting the characteristic αββα fold seen in the metallo-β-lactamase superfamily .

What structural features are predicted for aq_1964?

Based on comparable metalloproteases from A. aeolicus, aq_1964 likely exhibits a structure consistent with the metallo-β-lactamase (MBL) superfamily's αββα fold. This structural arrangement would include a zinc-binding domain containing highly conserved histidine and aspartate residues that coordinate zinc ions essential for catalytic activity. Circular dichroism spectroscopy of similar A. aeolicus proteins has confirmed secondary structure compositions consistent with this fold . The protein likely possesses structural adaptations that contribute to thermostability, such as increased hydrophobic interactions, additional salt bridges, and optimized surface charge distributions – features commonly observed in proteins from hyperthermophiles like A. aeolicus that need to function optimally at temperatures around 85°C .

How does the hyperthermophilic nature of Aquifex aeolicus influence aq_1964 properties?

The hyperthermophilic nature of A. aeolicus significantly impacts the properties of aq_1964, conferring extraordinary thermostability that allows it to maintain activity at extremely high temperatures. Similar enzymes from A. aeolicus demonstrate optimal activity at approximately 85°C . This thermostability is likely achieved through several structural adaptations including: increased numbers of ion-pairs within and between protein helices, enhanced hydrophobic core packing, reduced surface loop flexibility, and strategic positioning of proline residues. Additionally, the zinc-binding site would be expected to remain stable at high temperatures, maintaining the precise coordination geometry required for catalytic activity. Studies of other A. aeolicus proteins have shown they often possess more primitive multi-subunit organizations compared to their mesophilic counterparts, reflecting the deep evolutionary position of this organism .

What expression systems are recommended for recombinant production of aq_1964?

For recombinant production of aq_1964, an E. coli-based expression system utilizing a pLex vector or similar expression vector with a polyhistidine tag is recommended. This approach has proven successful for other A. aeolicus proteins, enabling high-level expression and subsequent single-step purification via metal-affinity chromatography . When designing the expression construct, researchers should consider:

  • Addition of an N-terminal polyhistidine tag to facilitate purification

  • Use of a strong promoter (such as T7) for high-level expression

  • Optimization of codon usage for E. coli if necessary

  • Incorporation of appropriate cloning sites for efficient insertion into the expression vector

The recombinant protein can be amplified by PCR from A. aeolicus genomic DNA and inserted into the expression vector for transformation into an appropriate E. coli strain such as BL21(DE3) . Expression conditions should be optimized for temperature, induction time, and inducer concentration to maximize protein yield while balancing protein solubility.

How can solubility issues be addressed when expressing aq_1964?

Solubility challenges are common when expressing thermophilic proteins in mesophilic hosts like E. coli, as evidenced by the tendency of other A. aeolicus proteins to form inclusion bodies . To address these solubility issues:

StrategyImplementationExpected Outcome
Denaturation-refoldingPurify under denaturing conditions (6-8M urea) followed by slow refoldingRecovery of properly folded, active protein
Co-expression with chaperonesExpress with chaperone proteins (GroEL/ES, DnaK)Improved folding and solubility
Lower expression temperatureReduce to 18-20°C during inductionSlower expression promoting proper folding
DNA-assisted refoldingRefold in the presence of DNA as a stabilizing agentEnhanced recovery of active protein
Fusion partnersExpress with solubility tags (MBP, SUMO, etc.)Increased solubility of the target protein

The refolding approach has proven particularly effective for other A. aeolicus proteins, where inclusion bodies are solubilized in high concentrations of urea (8M) and the protein is subsequently refolded in the presence of calf thymus DNA, which appears to stabilize the protein structure during the refolding process .

What purification methods are effective for recombinant aq_1964?

Based on successful approaches with other A. aeolicus proteins, an effective purification strategy for aq_1964 would involve:

  • Immobilized metal affinity chromatography (IMAC) utilizing the His-tag, which can be performed under either native conditions (if the protein is soluble) or denaturing conditions (if recovery from inclusion bodies is necessary) .

  • Heat treatment (thermal precipitation) at 70-75°C to denature E. coli proteins while leaving the thermostable aq_1964 in solution. This exploits the thermostability of A. aeolicus proteins and provides a simple purification step that significantly enhances purity .

  • For highest purity, a combination approach is recommended: initial heat treatment followed by two consecutive IMAC steps under denaturing conditions, with a refolding protocol between purification stages .

  • Size exclusion chromatography as a final polishing step to ensure homogeneity of the purified protein and to confirm its oligomeric state.

This multi-step approach has been demonstrated to yield highly pure, active thermostable proteins from A. aeolicus and would likely be effective for aq_1964 purification .

What is the predicted catalytic mechanism of aq_1964?

The catalytic mechanism of aq_1964 likely follows the general zinc metalloprotease mechanism, where the zinc ion plays a crucial role in polarizing a water molecule to generate a nucleophile for peptide bond hydrolysis. Based on studies of similar metalloproteases, the mechanism would involve:

  • Substrate binding in the active site through interactions with specific recognition residues

  • Coordination of the zinc ion by conserved histidine and aspartate/glutamate residues

  • Activation of a water molecule by the zinc ion, generating a hydroxide nucleophile

  • Nucleophilic attack of the hydroxide on the carbonyl carbon of the peptide bond

  • Formation of a tetrahedral intermediate stabilized by the zinc ion

  • Collapse of the intermediate, breaking the peptide bond

  • Release of the cleaved products

The specific residues involved in zinc binding could be identified through site-directed mutagenesis, similar to approaches used for the Zmp1 metalloprotease, where key residues for zinc coordination and catalytic activity were determined . The reaction is expected to be highly dependent on the presence of zinc ions, and activity would likely be abolished by metal chelators like EDTA.

What are appropriate substrates for assaying aq_1964 activity?

While the natural substrates of aq_1964 remain to be definitively identified, various synthetic and biological substrates can be used to assay its activity:

Substrate TypeExamplesDetection Method
Synthetic peptidesFRET-labeled peptides with quencher and fluorophoreFluorescence increase upon cleavage
Chromogenic substratesp-nitrophenyl derivativesSpectrophotometric detection at 405 nm
Protein substratesFibronectin, fibrinogen, caseinSDS-PAGE analysis of degradation products
ZymographyGelatin or casein incorporated into gelsClear zones of hydrolysis after staining

Fibronectin and fibrinogen would be particularly appropriate initial candidates, as these have been shown to be substrates for other zinc metalloproteases like Zmp1 . A zinc-dependent hydrolytic activity assay could be developed using these substrates, monitoring cleavage products by SDS-PAGE or Western blotting. For quantitative kinetic analysis, fluorogenic peptide substrates containing appropriate cleavage sites would allow continuous monitoring of enzyme activity through increased fluorescence upon substrate hydrolysis.

How does temperature affect the enzymatic activity of aq_1964?

As a protein from the hyperthermophile A. aeolicus, aq_1964 would be expected to display maximum enzymatic activity at elevated temperatures, likely around 85°C, similar to other enzymes from this organism . The temperature dependence of activity would show:

  • Low activity at room temperature (20-25°C)

  • Gradually increasing activity with temperature

  • Optimal activity at temperatures around 80-90°C

  • Sharp decrease in activity at temperatures exceeding the optimum due to protein unfolding

When designing activity assays, temperature control is critical, and reactions should be conducted at multiple temperatures to determine the optimal conditions. The thermostability of substrates must also be considered, as many conventional substrates may degrade at the high temperatures where aq_1964 functions optimally. For long-term stability studies, protein activity should be measured after pre-incubation at various temperatures for different time periods to assess the thermal resistance of the enzyme's structure .

Which residues are critical for zinc binding in aq_1964?

The critical residues for zinc binding in aq_1964 are likely histidine, aspartate, and potentially cysteine residues arranged in conserved motifs typical of zinc metalloproteases. Based on studies of similar metalloproteases, the following residues would be candidates for site-directed mutagenesis to confirm their role in zinc binding:

  • Histidine residues in the conserved HEXXH motif, where the two histidines coordinate the zinc ion

  • A downstream glutamate (or aspartate) that serves as the third zinc ligand

  • Additional histidine or cysteine residues that may provide the fourth coordination position

What structural features contribute to the thermostability of aq_1964?

The thermostability of aq_1964, like other proteins from hyperthermophilic organisms, likely results from multiple structural features working in concert:

Structural FeatureContribution to ThermostabilityMethod of Analysis
Intra-helix ion pairsStabilize secondary structure elementsMutational analysis of charged residues
Inter-helix ion pairsMaintain tertiary structure at high temperaturesStructural comparison with mesophilic homologs
Hydrophobic core packingEnhanced core density reduces thermal fluctuationsCavity analysis using computational methods
Reduced surface loopsFewer flexible regions susceptible to thermal denaturationComparison of sequence length with mesophilic variants
Strategic proline positioningRestricts backbone flexibilitySequence analysis for proline enrichment
Disulfide bondsCovalent cross-links enhance structural rigidityThiol modification and reducing agent sensitivity

Studies of other thermostable proteins from A. aeolicus and related hyperthermophiles have shown that these adaptations collectively contribute to maintaining protein structure and function at temperatures that would denature most mesophilic proteins . Analysis of the primary sequence using computational tools can predict which of these features may be prominent in aq_1964, guiding experimental approaches to confirm their contribution to thermostability.

How conserved is aq_1964 across different species?

Aq_1964 likely shows a conservation pattern reflecting the deep evolutionary position of A. aeolicus in the bacterial domain. As a zinc metalloprotease, the protein would be expected to display:

A. aeolicus occupies one of the deepest branches in the bacterial domain, suggesting that aq_1964 may represent a primitive form of zinc metalloproteases, potentially exhibiting a more ancestral structure compared to homologs in later-branching organisms . Comprehensive phylogenetic analysis would be required to determine if aq_1964 represents a conserved ancestral form or if it has undergone significant adaptation specific to the hyperthermophilic lifestyle of A. aeolicus.

What can phylogenetic analysis reveal about the evolution of aq_1964?

Phylogenetic analysis of aq_1964 could provide valuable insights into the evolution of zinc metalloproteases and adaptation to extreme environments:

  • The relationship between aq_1964 and homologs in other thermophiles versus mesophiles, revealing adaptation patterns to different temperature ranges

  • The potential role of horizontal gene transfer in the acquisition or evolution of aq_1964, particularly given the ecological association between A. aeolicus and other organisms in hydrothermal environments

  • Evidence for gene fusion events, as many enzymes in A. aeolicus are present as multi-subunit forms that appear fused in later-branching organisms

  • The extent of selective pressure on different regions of the protein, revealing functionally important domains

Such analysis would contribute to ongoing debates about the position of Aquificales within the tree of life, potentially supporting the deep-branching hypothesis for this group . Comparative genomic approaches could also reveal whether aq_1964 represents a core component of the Aquifex proteome or a more specialized adaptation.

How can researchers identify the natural substrates of aq_1964?

Identifying the natural substrates of aq_1964 requires a multi-faceted approach:

ApproachMethodologyExpected Outcome
In vitro screeningTesting purified aq_1964 against candidate proteins from A. aeolicusDirect identification of cleavable substrates
Proteomics approachMass spectrometry analysis of A. aeolicus proteome with and without active aq_1964Identification of proteins with altered abundance or N/C termini
Substrate phage displayScreening peptide libraries displayed on phage surfacesDetermination of cleavage site preferences
Co-immunoprecipitationPulling down proteins that interact with catalytically inactive aq_1964Identification of binding partners
Bioinformatic predictionAnalysis of potential substrates based on homology to known metalloprotease substratesGeneration of candidate substrate list

The proteomics approach using liquid chromatography-tandem mass spectrometry would be particularly powerful, as it has been successfully applied to identify extracellular proteins of other organisms, including novel metalloproteases . For validation, candidate substrates could be recombinantly expressed and tested in vitro with purified aq_1964, monitoring for specific cleavage patterns using SDS-PAGE and mass spectrometry to identify precise cleavage sites.

What is the potential role of aq_1964 in Aquifex aeolicus physiology?

The physiological role of aq_1964 in A. aeolicus must be considered in the context of this organism's unique metabolism and habitat:

  • As a zinc metalloprotease, aq_1964 may participate in protein turnover critical for maintaining cellular function in extreme environments where protein damage may occur more rapidly

  • It could be involved in the processing of specific proteins required for the chemoautotrophic lifestyle of A. aeolicus, potentially affecting pathways involved in carbon fixation or energy metabolism

  • The enzyme may contribute to remodeling of the cell envelope in response to environmental stresses

  • Given the similarity of some metalloproteases to antibiotic resistance enzymes (e.g., metallo-β-lactamases), aq_1964 might provide protection against antimicrobial compounds present in the natural environment

A. aeolicus has a minimal but highly specialized metabolism adapted to its hyperthermophilic, chemolithoautotrophic lifestyle . Understanding aq_1964's role requires considering its potential contributions to these specialized metabolic pathways, particularly those that may represent ancient forms of core cellular processes.

What mass spectrometry approaches are useful for characterizing aq_1964?

Several mass spectrometry techniques can provide valuable insights into aq_1964 structure and function:

  • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for:

    • Protein identification and confirmation of sequence

    • Detection of post-translational modifications

    • Identification of cleavage products when studying substrate specificity

    • Analysis of protein-protein interactions through cross-linking MS

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for:

    • Mapping flexible versus rigid regions of the protein

    • Identifying conformational changes upon substrate binding

    • Characterizing the dynamics of thermostability

  • Native MS for:

    • Determining the oligomeric state of the protein

    • Confirming zinc binding and stoichiometry

    • Studying ligand binding directly

  • Top-down proteomics for:

    • Complete characterization of the intact protein

    • Identification of proteoforms and modifications

LC-MS/MS has been successfully applied to analyze bacterial exoproteomes, leading to the identification of novel metalloproteases and their activities . For thermostable proteins like aq_1964, HDX-MS can be particularly valuable for understanding which regions remain rigid even at elevated temperatures, providing insights into the structural basis for thermostability.

How can molecular dynamics simulations contribute to understanding aq_1964 function?

Molecular dynamics (MD) simulations offer powerful insights into the structure-function relationship of aq_1964, particularly in the context of its thermostability and catalytic mechanism:

  • Temperature-dependent simulations can reveal:

    • Structural elements that remain stable at elevated temperatures

    • Regions that undergo local unfolding first during thermal denaturation

    • Water molecules with extended residence times in the active site

  • Active site dynamics analysis can elucidate:

    • Zinc coordination geometry and fluctuations

    • Water positioning and activation for nucleophilic attack

    • Substrate binding pocket flexibility and specificity determinants

  • Substrate docking and catalytic mechanism studies provide insights into:

    • Substrate recognition and binding modes

    • Conformational changes upon substrate binding

    • Energy barriers for catalytic steps

  • Comparative simulations with mesophilic homologs help identify:

    • Key differences in dynamics contributing to thermostability

    • Evolutionary adaptations in flexibility and rigidity

These simulations would need to be conducted with specialized force fields that accurately represent zinc coordination chemistry, and the results would guide experimental approaches such as site-directed mutagenesis for validating the importance of specific residues . For a hyperthermophilic enzyme like aq_1964, simulations at elevated temperatures (80-90°C) would be particularly valuable for understanding its natural functional dynamics.

How can aq_1964 be used as a model system for studying enzyme thermostability?

Aq_1964 represents an excellent model system for studying enzyme thermostability for several reasons:

  • It originates from one of the most thermophilic bacteria known, with an optimal growth temperature of approximately 85°C

  • It likely contains multiple thermostabilizing features that can be systematically analyzed

  • As a metalloprotease, its activity can be easily assayed using various substrates

  • Its deep evolutionary position provides insights into ancient adaptations to high temperatures

Researchers can utilize aq_1964 to:

Research ApproachMethodologyKnowledge Gain
Comparative analysisContrast with mesophilic homologsIdentify key thermostabilizing features
Progressive mutagenesisSystematic replacement of putative thermostabilizing featuresQuantify contribution of each feature
Chimeric enzyme constructionSwap domains between thermophilic and mesophilic variantsIdentify independently folding thermostable domains
Directed evolutionSelection for variants with enhanced/reduced thermostabilityDiscover novel thermostabilizing mechanisms
Computational designPredict stabilizing mutations based on structural analysisTest accuracy of thermostability prediction algorithms

The insights gained from such studies extend beyond aq_1964 itself, contributing to broader understanding of protein thermostability principles that can be applied to engineer other enzymes for biotechnological applications requiring high-temperature stability .

What are the challenges and strategies for designing inhibitors of aq_1964?

Designing effective inhibitors for aq_1964 presents several challenges, particularly related to its thermophilic nature, but multiple strategies can be employed:

Challenges:

  • Inhibitors must maintain stability at elevated temperatures where the enzyme is active

  • The binding pocket may differ significantly from mesophilic homologs, limiting the utility of known inhibitors

  • Testing conditions must account for the temperature optimum of the enzyme

  • Inhibitor binding may be affected by different dynamics at high temperatures

Strategies:

  • Structure-based design:

    • Computational docking of candidate molecules to the active site

    • Focus on transition state analogs that coordinate the zinc ion

    • Design of covalent inhibitors targeting specific residues near the active site

  • Fragment-based approaches:

    • Screening of small molecule fragments that bind to different regions

    • Linking of fragments to create high-affinity inhibitors

    • Thermal shift assays to identify fragments that stabilize the protein

  • Peptide-based inhibitors:

    • Design based on substrate specificity profiling

    • Incorporation of non-natural amino acids resistant to high temperatures

    • Cyclization to enhance thermal stability

  • Natural product screening:

    • Testing compounds from thermophilic organisms that may have co-evolved inhibitory properties

    • Focus on compounds with inherent thermal stability

Similar approaches have been successful for other metalloproteases, and compounds like O6-benzylguanine that inhibit other A. aeolicus enzymes demonstrate that effective inhibition of thermostable proteins is achievable . Development of such inhibitors would provide valuable tools for studying the biological function of aq_1964 and potentially lead to broader applications in research and biotechnology.

What are the most pressing unanswered questions about aq_1964?

Despite advances in our understanding of A. aeolicus proteins, several critical questions about aq_1964 remain unanswered:

  • What is the precise physiological role of aq_1964 in the extreme environment where A. aeolicus thrives?

  • What are the natural substrates of this putative metalloprotease in vivo?

  • How does the structure of aq_1964 compare to metalloproteases from mesophilic organisms?

  • What specific molecular adaptations enable this enzyme to function at extreme temperatures?

  • How has the evolutionary history of this enzyme been shaped by the deep-branching position of A. aeolicus?

Addressing these questions will require integrated approaches combining structural biology, enzymology, comparative genomics, and in vivo studies. The answers will contribute not only to our understanding of this specific protein but also to broader knowledge about enzyme adaptation to extreme environments and the evolution of protein function .

How might research on aq_1964 contribute to broader scientific understanding?

Research on aq_1964 has the potential to contribute significantly to multiple scientific domains:

  • Evolutionary biology: As a protein from one of the earliest diverging bacterial lineages, aq_1964 provides insights into ancient protein structures and functions, potentially revealing features of primordial metalloproteases .

  • Extremophile adaptation: Understanding how aq_1964 functions at high temperatures contributes to our knowledge of molecular adaptations to extreme environments, with implications for astrobiology and the limits of life.

  • Protein engineering: The thermostabilizing features of aq_1964 could inform the design of enzymes with enhanced stability for industrial applications requiring operation at elevated temperatures.

  • Metalloenzyme catalysis: Studies of zinc coordination and catalytic mechanism in aq_1964 may reveal general principles applicable to the broader family of metalloproteases.

  • Minimal metabolism models: As part of the streamlined genome of A. aeolicus, understanding aq_1964's role contributes to models of minimal metabolic requirements for life in extreme environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.