Recombinant Aquifex aeolicus Uncharacterized protein aq_1012 (aq_1012)

What is Aquifex aeolicus Uncharacterized Protein Aq_1012 and what are its basic properties?

Aquifex aeolicus uncharacterized protein Aq_1012 is a 154-amino acid protein (UniProt ID: O67127) derived from the hyperthermophilic bacterium Aquifex aeolicus. The full amino acid sequence is: MKETIISSMEKFIQKFFEELYLILFDYALKIAQNPIDELLIFGSIAIAYTVIYISGLFFARKINLPYIRKILEIGISVIFYFLVSLLEGKFPQVESLLLLKTLFLVQTIRVFILSLEAFQAFGFTTKLLINIFSILGGISFFIIKLSPFTRRKI .

The protein has not been fully characterized functionally, but its sequence suggests potential membrane-associated properties based on the prevalence of hydrophobic residues. Given the hyperthermophilic nature of Aquifex aeolicus, which thrives at temperatures between 85-95°C, Aq_1012 likely exhibits considerable thermostability, similar to other proteins from this organism such as Aq_880 .

What are the recommended expression systems for recombinant Aq_1012 production?

For optimal expression of recombinant Aq_1012, Escherichia coli represents the preferred heterologous expression system as demonstrated in current protocols. The protein can be successfully expressed with an N-terminal His-tag to facilitate purification . When designing expression constructs, consider the following methodological approach:

• Clone the full-length Aq_1012 gene (encoding amino acids 1-154) into an appropriate expression vector with a His-tag

• Transform into an E. coli expression strain suitable for thermostable proteins

• Induce expression under optimized conditions (temperature, IPTG concentration, duration)

• Purify using nickel affinity chromatography

• Consider additional purification steps such as size-exclusion chromatography if higher purity is required

Based on experience with other thermostable proteins from A. aeolicus, maintaining the native sequence without codon optimization may preserve thermostability features, though this should be experimentally validated for Aq_1012 specifically.

How should recombinant Aq_1012 be stored to maintain stability and activity?

To maintain the stability and potential activity of recombinant Aq_1012, implement the following evidence-based storage protocol:

• Upon purification, store the protein at -20°C/-80°C

• For short-term usage, working aliquots can be maintained at 4°C for up to one week

• Avoid repeated freeze-thaw cycles as these can significantly reduce protein integrity

• For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being standard practice)

• Consider lyophilization in Tris/PBS-based buffer with 6% trehalose at pH 8.0

When reconstituting the protein, centrifuge the vial briefly before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. This approach minimizes protein denaturation and loss of potential functional activity during storage periods.

What bioinformatic approaches can help predict the function of uncharacterized Aq_1012?

Methodological approach to predicting Aq_1012 function through bioinformatics:

• Sequence-based analysis:

  • Perform position-specific iterated BLAST (PSI-BLAST) against non-redundant protein databases

  • Identify conserved domains using InterPro, Pfam, and SMART databases

  • Conduct multiple sequence alignment with homologs using Clustal X and visualize with ESPript 3.0 as demonstrated with other A. aeolicus proteins

• Structural prediction:

  • Generate structural models using AlphaFold or RoseTTAFold

  • Compare predicted structures with known protein folds using Dali or FATCAT

  • Analyze hydrophobic regions for potential membrane interactions

• Evolutionary analysis:

  • Construct phylogenetic trees to identify related proteins with known functions

  • Examine synteny of the aq_1012 gene within the A. aeolicus genome and related species

  • Investigate potential horizontal gene transfer events, as observed with other A. aeolicus proteins

• Functional association networks:

  • Use STRING or similar tools to predict functional associations

  • Examine gene neighborhood and co-expression patterns

  • Identify potential interaction partners through comparative genomics

This systematic approach can generate testable hypotheses regarding Aq_1012's function, which can then guide experimental design for functional characterization.

How should crystallization trials for Aq_1012 be designed, considering the hyperthermophilic origin of this protein?

For crystallization of hyperthermophilic proteins like Aq_1012, implement this methodological approach adapted from successful crystallization of other A. aeolicus proteins:

• Initial screening strategy:

  • Perform primary screening with commercial kits such as Crystal Screen 2 HR2-112 and HR2-110 (Hampton Research), and Wizard CRYOI and CRYOII (Rigaku)

  • Use sitting drop vapor diffusion format at both standard (20°C) and elevated temperatures (30-37°C)

  • Optimize buffer conditions around pH 7.0 with varying concentrations of PEG8000 (4-8%) and glycol (8-12%)

• Optimization considerations:

  • For promising conditions, proceed to hanging-drop vapor diffusion with 1 μL protein solution (0.2-0.3 mM) and 1 μL reservoir solution

  • Consider including stabilizing ligands if potential binding partners are identified

  • Incorporate thermostability elements by including ionic compounds that mimic the hyperthermophilic environment

• Data collection preparation:

  • Flash-cool crystals to ~100K using liquid nitrogen with cryo-protectant containing similar buffer components

  • Collect diffraction data at synchrotron facilities with beam wavelength around 0.97-1.0 Å

This approach accounts for the unique properties of hyperthermophilic proteins, which often possess enhanced conformational stability that can facilitate crystallization under conditions that preserve their native structure.

What mass spectrometry approaches are optimal for detailed characterization of recombinant Aq_1012?

For comprehensive mass spectrometry-based characterization of recombinant Aq_1012, employ a multi-layered analytical approach:

• Protein identification and verification:

  • Perform in-solution or in-gel tryptic digestion of purified Aq_1012

  • Analyze peptides using LC-MS/MS with high-resolution mass spectrometers

  • Match experimental spectra against theoretical peptides using search algorithms

  • Verify sequence coverage and examine post-translational modifications

• Intact mass analysis:

  • Determine the exact molecular weight of the intact protein using ESI-MS

  • Compare experimental mass with theoretical mass to confirm protein integrity

  • Identify potential heterogeneity, truncations, or modifications

• Quantitative analysis:

  • Implement quantitative proteomics following the mzQuantML data standard

  • Use <ProteinList> data architecture to organize abundance values per assay

  • Structure data to include <AssayQuantLayer>, <StudyVariableQuantLayer>, and <GlobalQuantLayer> components

• Conformational studies:

  • Apply hydrogen-deuterium exchange MS (HDX-MS) to probe solution-phase dynamics

  • Use native MS to examine oligomeric states and potential ligand interactions

  • Consider ion mobility-MS to investigate conformational ensembles

This integrated MS approach provides comprehensive characterization of Aq_1012, from sequence verification to higher-order structural features.

How can quasi-experimental approaches be applied to study potential functions of Aq_1012 in cellular contexts?

When investigating the uncharacterized Aq_1012 protein in cellular contexts, quasi-experimental designs offer robust methodological frameworks:

• Non-equivalent groups design:

  • Compare cellular responses between wild-type A. aeolicus and aq_1012 knockout/knockdown strains

  • Measure physiological parameters under varying temperature conditions (75-95°C)

  • Analyze growth rates, metabolic profiles, and stress responses

  • Control for pre-existing differences using statistical adjustments

• Interrupted time-series design:

  • Monitor cellular parameters before and after inducing aq_1012 expression

  • Collect data at multiple time points to establish baseline and post-intervention trends

  • Apply segmented regression analysis to quantify intervention effects

  • Control for temporal confounds through appropriate statistical modeling

• Regression discontinuity design:

  • Utilize natural thresholds in cellular systems (e.g., temperature sensitivity)

  • Examine cellular responses closely around threshold points

  • Apply statistical analyses that account for the discontinuity at the threshold

  • Draw causal inferences about Aq_1012 function near transition points

These quasi-experimental approaches allow researchers to derive meaningful insights into Aq_1012's potential functions even when ideal experimental conditions are unattainable, particularly given the challenges of working with hyperthermophilic organisms.

What enzymatic assays should be prioritized when screening for potential catalytic activities of Aq_1012?

Based on structural predictions and the characteristics of other A. aeolicus proteins, a systematic enzymatic screening approach for Aq_1012 should include:

For each assay, perform thermal optimization experiments at temperatures ranging from 37-95°C to determine optimal conditions for potential enzymatic activity. Additionally, conduct metal dependency screens using divalent cations (Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺) as cofactors, given their importance in many thermostable enzymes from A. aeolicus.

How should site-directed mutagenesis experiments be designed to probe structure-function relationships in Aq_1012?

A systematic mutagenesis approach to investigate structure-function relationships in Aq_1012 should follow this methodological framework:

• Target residue selection:

  • Identify highly conserved residues through multiple sequence alignment with homologs

  • Focus on putative catalytic residues (Asp, Glu, His, Cys, Ser) in predicted active sites

  • Select charged/polar residues in potential ligand-binding pockets

  • Target hydrophobic residues in predicted membrane-interacting regions

• Mutagenesis strategy:

  • Create alanine substitutions to eliminate side chain functionality

  • Generate conservative substitutions to preserve charge/polarity while altering size

  • Introduce cysteine residues at potential interaction interfaces for crosslinking studies

  • Design thermostability-altering mutations based on comparison with mesophilic homologs

• Functional analysis pipeline:

  • Express wild-type and mutant proteins in parallel under identical conditions

  • Verify proper folding using circular dichroism and thermal denaturation assays

  • Assess functional parameters using established activity assays

  • Determine kinetic parameters (kcat, KM) for catalytically active variants

This approach mirrors successful mutagenesis studies of other A. aeolicus proteins, such as the identification of catalytic aspartate residues (D138, D142, D160) in Aq_880, where mutation to alanine abolished activity while D144A retained function . By systematically probing the importance of specific residues, researchers can map functional domains within Aq_1012.

How does Aq_1012 compare with other uncharacterized proteins in hyperthermophilic bacteria?

A comprehensive comparative analysis of Aq_1012 with other uncharacterized proteins from hyperthermophilic bacteria reveals several key insights:

• Sequence-level comparison:

  • Perform comprehensive BLAST analysis against proteomes of other hyperthermophiles (Thermotoga, Thermus, Pyrococcus)

  • Identify sequence motifs unique to hyperthermophilic variants versus mesophilic homologs

  • Quantify amino acid compositional bias, notably increased charged residues (Arg, Glu, Lys) and decreased thermolabile residues (Asn, Gln)

• Structural adaptations:

  • Compare predicted or determined structures focusing on thermostabilizing features

  • Analyze ionic interaction networks that confer thermostability

  • Examine hydrophobic core packing efficiency as a thermostability determinant

• Evolutionary trajectory:

  • Construct phylogenetic trees to trace evolutionary history

  • Identify potential horizontal gene transfer events, similar to what was observed with Aq_880, which was acquired from Archaea

  • Analyze selection pressure patterns using dN/dS ratios across different lineages

This comparative approach contextualizes Aq_1012 within the broader landscape of hyperthermophilic proteins, potentially revealing convergent adaptations and shared functional characteristics among proteins that have evolved to function at extreme temperatures.

What evidence would suggest horizontal gene transfer as the origin of aq_1012 in the A. aeolicus genome?

To evaluate the hypothesis of horizontal gene transfer (HGT) for aq_1012, a structured analytical approach should be implemented:

• Sequence-based indicators:

  • Identify anomalous GC content or codon usage patterns compared to the A. aeolicus genome average

  • Calculate the Codon Adaptation Index (CAI) to detect non-typical codon preferences

  • Search for mobile genetic elements or integration sites near the aq_1012 locus

• Phylogenetic evidence:

  • Construct robust phylogenetic trees using maximum likelihood or Bayesian methods

  • Look for incongruence between aq_1012 gene tree and species phylogeny

  • Identify unexpected clustering with distantly related organisms, potentially Archaea as observed with other A. aeolicus proteins

• Genomic context analysis:

  • Examine synteny conservation or disruption around aq_1012

  • Identify potential operonic structures that may have been horizontally transferred

  • Search for co-transferred genes that maintain functional relationships

• Comparative temporal analysis:

  • Estimate the timing of potential HGT events using relative rate tests

  • Compare with other known HGT events in the A. aeolicus lineage

  • Correlate with ecological or evolutionary transitions in the species' history

This methodological framework allows researchers to systematically evaluate the evolutionary origin of aq_1012, potentially revealing insights into the genetic exchange networks that have shaped the A. aeolicus genome through its evolutionary history.

How can recombinant Aq_1012 be engineered for enhanced thermostability in biotechnological applications?

To enhance the already considerable thermostability of Aq_1012 for biotechnological applications, implement this engineering methodology:

• Computational design approach:

  • Perform in silico analysis to identify potential destabilizing regions

  • Use Rosetta energy calculations to predict stabilizing mutations

  • Implement consensus design by aligning with other hyperthermophilic homologs

  • Conduct molecular dynamics simulations at elevated temperatures to identify flexible regions

• Targeted mutagenesis strategies:

  • Introduce additional salt bridges through charged residue placement

  • Optimize hydrophobic core packing with bulkier hydrophobic residues

  • Reduce conformational entropy of unfolded state by replacing glycines

  • Introduce proline residues in loop regions to restrict conformational flexibility

• Directed evolution framework:

  • Develop high-throughput screening assays compatible with extreme temperatures

  • Implement error-prone PCR with selection at incrementally increasing temperatures

  • Combine beneficial mutations through DNA shuffling techniques

  • Perform saturation mutagenesis at key positions identified in computational analysis

• Validation protocol:

  • Measure thermal denaturation curves using differential scanning calorimetry

  • Determine half-life at various elevated temperatures (95-120°C)

  • Assess kinetic parameters at different temperatures to calculate activation energies

  • Compare catalytic efficiency at elevated temperatures with wild-type protein

This comprehensive protein engineering approach has successfully been applied to other thermostable enzymes from A. aeolicus, such as Aq_880, which maintains activity even after preincubation at 85°C .

What heterologous expression systems could improve the yield and quality of recombinant Aq_1012 for structural studies?

To optimize heterologous expression of Aq_1012 for structural studies, consider this methodological comparison of expression systems:

For crystallization studies specifically, consider implementing:

• Surface entropy reduction mutations to enhance crystal contacts

• Truncation constructs to remove flexible regions identified by limited proteolysis

• Fusion partners (T4 lysozyme, BRIL) to facilitate crystallization

• In situ proteolysis during crystallization to remove flexible tags

This strategic approach to expression system selection and protein engineering can significantly improve the likelihood of obtaining diffraction-quality crystals for structural studies of Aq_1012.