Recombinant Aquifex aeolicus Uncharacterized protein aq_1188 (aq_1188)

Shipped with Ice Packs
In Stock

Description

Biochemical and Functional Insights

While Aq_1188 remains uncharacterized functionally, its recombinant form has been studied for basic biochemical properties:

  • Structural Features: The protein lacks known enzymatic domains or motifs, but its sequence includes hydrophobic regions suggestive of membrane association .

  • Thermophile Origin: A. aeolicus is a hyperthermophilic bacterium, implying potential thermostability in Aq_1188, though experimental validation is pending .

  • Interactions: Current databases list no confirmed interacting proteins or pathways, though bioinformatic analyses suggest hypothetical roles in cellular processes common to thermophiles .

Research Applications and Availability

Recombinant Aq_1188 is marketed as a tool for structural or functional studies. Commercial vendors provide it in multiple formats:

Product CodeSourceTagConjugate
RFL27567AFE. coliHis-tagNone
CSB-EP524756DNVE. coliAvi-tagBiotinylated

Applications may include:

  • Antibody development for thermophile proteomics.

  • Structural studies (e.g., crystallography, NMR) to resolve uncharacterized protein folds.

  • Screening for enzymatic activity under high-temperature conditions.

Knowledge Gaps and Future Directions

Despite its availability, critical gaps persist:

  • Functional Annotation: No peer-reviewed studies confirm enzymatic activity, substrate binding, or biological role.

  • Structural Data: The absence of crystallographic or cryo-EM structures limits mechanistic insights.

  • Thermophile Adaptation: Potential contributions to A. aeolicus’ extremophile biology (e.g., RNA maturation, stress response) remain unexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we can accommodate specific format requirements. Please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance for arrangements and additional fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
aq_1188; Uncharacterized protein aq_1188
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
aq_1188
Target Protein Sequence
MTFLFLILVFIIEILQLSVFPPIFGNAYIVPSLAFLLVLFSSYKIKEKALLLAFLSGLFY DAVVNFLGFISLLNVVFTYLYLVLNNILFVKNPKVEVFLIMPLILLLRKLTIFLVVNTKF PLNIGLKDFGVVLLIDLIFLILLYKVFNKYVYEKA
Uniprot No.

Target Background

Database Links

KEGG: aae:aq_1188

STRING: 224324.aq_1188

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of studying proteins from Aquifex aeolicus?

Aquifex aeolicus holds particular evolutionary significance as one of the deepest-branching and most thermophilic bacteria known. It occupies a unique position in the bacterial domain of the tree of life, making its proteins valuable for studying early evolutionary events .

Research methodological approach:

  • Conduct phylogenetic analyses comparing aq_1188 homologs across bacterial domains

  • Perform structural comparisons with similar proteins in mesophilic organisms

  • Examine conserved domains to identify ancestral protein features

  • Analyze amino acid composition to understand thermoadaptation mechanisms

Studying uncharacterized proteins like aq_1188 can provide insights into the minimal metabolic requirements of early life forms and the adaptations necessary for survival in extreme environments. Aquifex aeolicus is particularly valuable because it likely retains many ancestral metabolic features due to the long-term stability of its hydrothermal vent habitat .

How should researchers properly reconstitute and store the lyophilized aq_1188 protein for experimental use?

For optimal experimental outcomes, follow this methodological protocol:

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening to collect the lyophilized material at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended: 50%)

  • Prepare working aliquots to minimize freeze-thaw cycles

Storage Recommendations:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Store reconstituted working aliquots at 4°C for up to one week

  • Store long-term aliquots at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they significantly compromise protein stability

When designing experiments, researchers should account for the thermophilic nature of this protein and consider temperature-dependent activity assays. The optimal buffer systems may differ from those used with mesophilic proteins, and special attention should be paid to maintaining proper folding at various temperatures.

How can researchers effectively design experiments to determine the function of this uncharacterized protein?

When investigating an uncharacterized protein like aq_1188, a systematic multi-disciplinary approach is recommended:

Step 1: Bioinformatic Analysis

  • Conduct sequence homology searches across diverse databases

  • Perform structural prediction using tools like AlphaFold or RoseTTAFold

  • Analyze transmembrane topology patterns

  • Identify conserved domains and potential active sites

Step 2: Expression System Optimization

  • Compare expression efficiency in different E. coli strains

  • Test varied induction conditions (temperature, IPTG concentration, induction time)

  • Evaluate solubility enhancement strategies (fusion partners, detergents)

  • Consider membrane-mimetic environments for functional studies

Step 3: Biochemical Characterization

  • Determine thermal stability profile (Tm) at varying pH conditions

  • Perform ligand binding assays using thermal shift assays

  • Conduct differential scanning calorimetry

  • Investigate potential protein-protein interactions

Step 4: Functional Assays

  • Design assays based on predicted function or structural homology

  • Test activity across temperature range (20-95°C)

  • Examine potential enzymatic activities using substrate panels

  • Analyze potential membrane transport capabilities

This methodological framework should be adapted based on preliminary results, with particular attention to the hyperthermophilic nature of A. aeolicus (optimal growth at 85-95°C) when designing functional assays .

What are the optimal conditions for expressing recombinant aq_1188 protein in E. coli?

Based on available data and general protocols for thermophilic membrane proteins, researchers should consider the following optimized expression strategy:

Expression Host Selection:

Optimized Expression Protocol:

  • Transform the expression construct into the selected E. coli strain

  • Grow cultures at 37°C until OD600 reaches 0.6-0.8

  • Reduce temperature to 18-25°C before induction

  • Induce with 0.1-0.5 mM IPTG

  • Continue expression for 16-20 hours

  • Harvest cells and extract using appropriate detergents for membrane proteins

When working with a protein from a hyperthermophile like A. aeolicus, researchers should be aware that the protein may form inclusion bodies in E. coli. Strategies to improve solubility include using lower induction temperatures, adding solubility-enhancing tags, or employing specialized folding chaperones .

What analytical techniques are most appropriate for studying the membrane topology of aq_1188?

The uncharacterized aq_1188 protein appears to have multiple transmembrane regions based on sequence analysis. To experimentally determine its membrane topology, researchers should employ complementary techniques:

Primary Analytical Methods:

  • Cysteine Scanning Mutagenesis

    • Systematically replace non-essential residues with cysteine

    • Apply membrane-permeable and impermeable sulfhydryl reagents

    • Analyze accessibility patterns to map topology

  • Fluorescence Spectroscopy

    • Label specific residues with environment-sensitive fluorophores

    • Monitor spectral shifts indicative of membrane insertion

    • Perform quenching experiments to determine exposure

  • Protease Protection Assays

    • Express protein in appropriate membrane systems

    • Treat with proteases under controlled conditions

    • Identify protected fragments by mass spectrometry

  • Epitope Insertion and Antibody Accessibility

    • Insert epitope tags at predicted loops

    • Test accessibility using antibodies without membrane permeabilization

    • Compare results with permeabilized samples

Data Integration Framework:

  • Compile results from multiple techniques into a consensus topology model

  • Compare experimental data with computational predictions

  • Validate model with targeted cross-linking experiments

  • Refine with functional studies of strategic mutants

These methods should be calibrated considering the thermal stability of aq_1188 and the potential requirement for specialized membrane mimetics that accommodate proteins from hyperthermophiles .

How might researchers investigate the potential role of aq_1188 in the metabolic network of Aquifex aeolicus?

Investigating the metabolic role of this uncharacterized protein requires a systems biology approach integrating multiple lines of evidence:

Methodological Framework:

  • Comparative Genomic Analysis

    • Examine genomic context of aq_1188 for associated metabolic genes

    • Identify conserved gene clusters across related species

    • Compare expression patterns under varied growth conditions

  • Metabolic Network Integration

    • Position aq_1188 within the reconstructed metabolic network of A. aeolicus

    • Analyze potential interactions with known pathways

    • Perform flux balance analysis with and without functional constraints

  • Protein-Protein Interaction Studies

    • Conduct pull-down assays with tagged aq_1188

    • Perform cross-linking experiments followed by mass spectrometry

    • Use bacterial two-hybrid systems adapted for thermophilic proteins

  • Metabolomic Profiling

    • Compare metabolite profiles in wild-type vs. aq_1188 knockout/overexpression systems

    • Track isotope-labeled metabolites to identify affected pathways

    • Integrate results with transcriptomic data

A. aeolicus possesses a metabolic network optimized for a chemoautotrophic lifestyle in extreme environments. Given its deep-branching position, proteins like aq_1188 may represent conserved components of ancestral metabolic pathways. Research indicates that A. aeolicus synthesizes biomass through pathways that appear to represent conserved forms of ancestral metabolic routes , making the functional characterization of uncharacterized proteins particularly valuable for understanding early metabolic evolution.

What approaches can researchers use to investigate the thermostability mechanisms of aq_1188?

Understanding the molecular basis of thermostability in aq_1188 requires a comprehensive experimental strategy:

Thermal Stability Analysis Protocol:

  • Differential Scanning Calorimetry (DSC) and Circular Dichroism (CD)

    • Measure melting temperature (Tm) across pH range 4-10

    • Determine enthalpy and entropy of unfolding

    • Monitor secondary structure changes during thermal denaturation

  • Comparative Mutational Analysis

    • Identify residues unique to thermophilic homologs

    • Generate targeted mutations to mesophilic equivalents

    • Quantify stability changes in mutant proteins

  • Molecular Dynamics Simulations

    • Perform atomistic simulations at elevated temperatures (25-100°C)

    • Analyze protein flexibility and structural fluctuations

    • Identify stabilizing interactions and rigid substructures

  • Structural Analysis

    • Determine high-resolution structure via X-ray crystallography or cryo-EM

    • Analyze distribution of charged residues on surface

    • Quantify ion pair networks and hydrophobic packing

Expected Thermostability Features:

MechanismMeasurement MethodTypical Observation in Thermophiles
Ion pair networksStructure analysisIncreased surface charge interactions
Hydrophobic core packingBurial analysisGreater buried surface area
Reduced loop regionsStructure comparisonShorter, more rigid loops
Proline enrichmentSequence analysisHigher proline content in loops
Disulfide bondsBiochemical assaysStrategic cross-linking

A. aeolicus proteins frequently exhibit adaptive features for extreme thermostability, as they function optimally at temperatures approaching 95°C. Understanding these mechanisms in aq_1188 could provide insights into both protein evolution and potential biotechnological applications requiring thermostable components .

How can researchers determine if aq_1188 represents a novel protein fold or contains previously characterized domains?

Determining the structural novelty of aq_1188 requires a strategic approach combining computational and experimental methods:

Structural Characterization Strategy:

  • Advanced Homology Detection

    • Apply profile-based searches (HHpred, HMMER)

    • Implement fold recognition algorithms

    • Utilize sensitive structural alignment tools (DALI, FATCAT)

  • Ab Initio and AI-Enhanced Structure Prediction

    • Generate models using Rosetta ab initio protocols

    • Apply AlphaFold2 with deep MSA enhancement

    • Utilize hybrid modeling approaches for membrane proteins

  • Experimental Structure Determination

    • Optimize crystallization conditions for X-ray diffraction

    • Prepare samples for cryo-electron microscopy

    • Consider solid-state NMR for membrane-embedded regions

  • Structural Domain Analysis

    • Identify potential domain boundaries

    • Search for structural motifs conserved across protein families

    • Analyze domain architecture conservation across species

The structural characterization of aq_1188 is particularly valuable given the deep-branching position of A. aeolicus. Novel protein folds discovered in ancient lineages can provide insights into protein structure evolution and potentially reveal ancestral functional mechanisms. The integration of computational predictions with experimental validation is essential for reliable structural characterization, especially for membrane proteins from extremophiles where traditional structural biology approaches face significant challenges .

What is the current understanding of aq_1188's potential membrane transport functions?

Based on sequence analysis, aq_1188 shows characteristics of a membrane transport protein, though its specific substrates and transport mechanism remain uncharacterized. Researchers investigating potential transport functions should consider this methodological workflow:

Transport Function Investigation Protocol:

  • Substrate Prediction and Screening

    • Analyze sequence similarity to known transporters

    • Identify potential substrate-binding residues

    • Screen candidate substrates based on A. aeolicus metabolism

  • Reconstitution in Liposomes or Proteoliposomes

    • Purify protein in detergent-solubilized form

    • Incorporate into liposomes of varied lipid composition

    • Test transport activity using radioisotope or fluorescent substrates

  • Electrophysiological Studies

    • Express protein in Xenopus oocytes or patch-clamp compatible systems

    • Measure transport-associated currents

    • Determine ion coupling and stoichiometry

  • In vivo Transport Assays

    • Generate transport-deficient bacterial strains

    • Complement with aq_1188 expression constructs

    • Quantify rescued transport activity

When investigating membrane proteins from hyperthermophiles, researchers should be mindful that conventional transport assays may need adaptation for high-temperature conditions. Additionally, the lipid environment significantly impacts membrane protein function, so mimicking the native membrane composition of A. aeolicus (rich in ether lipids and saturated fatty acids) may be critical for observing authentic transport activity .

How can researchers investigate the potential role of aq_1188 in thermoadaptation of Aquifex aeolicus?

Investigating the role of aq_1188 in thermoadaptation requires a multi-faceted approach:

Thermoadaptation Investigation Framework:

  • Comparative Expression Analysis

    • Quantify expression levels across temperature gradients

    • Compare with expression patterns of known heat-shock proteins

    • Analyze promoter regions for temperature-responsive elements

  • Gene Knockout or Knockdown Studies

    • Generate conditional knockout strains if possible

    • Assess growth phenotypes at varied temperatures

    • Measure cellular stress responses in modified strains

  • Protein-Lipid Interaction Analysis

    • Determine lipid binding preferences

    • Analyze effects on membrane fluidity and permeability

    • Examine temperature-dependent changes in protein-lipid interactions

  • Stress Response Integration

    • Analyze interaction with known stress response pathways

    • Determine if aq_1188 is co-regulated with other thermoadaptation genes

    • Assess impact on cellular thermoprotection mechanisms

A. aeolicus thrives at temperatures of 85-95°C, requiring extensive molecular adaptations in all cellular components. Membrane proteins like aq_1188 may play crucial roles in maintaining membrane integrity and function under extreme thermal stress. The protein might be involved in specific adaptation mechanisms such as altered ion homeostasis, specialized metabolite transport, or membrane architecture stabilization that contribute to the organism's ability to survive in hydrothermal environments .

What approaches can researchers use to identify potential binding partners or interaction networks involving aq_1188?

Identifying the interaction network of an uncharacterized protein requires systematic application of complementary techniques:

Protein Interaction Mapping Protocol:

  • Affinity Purification-Mass Spectrometry (AP-MS)

    • Express tagged aq_1188 in native or heterologous systems

    • Perform pull-down experiments under varied conditions

    • Identify co-purifying proteins by mass spectrometry

    • Validate interactions with reciprocal pull-downs

  • Crosslinking Mass Spectrometry (XL-MS)

    • Apply membrane-permeable crosslinkers to intact cells

    • Isolate complexes containing aq_1188

    • Identify crosslinked peptides to map interaction interfaces

    • Generate spatial restraints for structural modeling

  • Bacterial Two-Hybrid Screening

    • Adapt systems for thermophilic protein interactions

    • Screen against genomic libraries of A. aeolicus

    • Validate positive interactions with alternative methods

    • Map minimal interaction domains

  • Co-evolution Analysis

    • Perform statistical coupling analysis across homologs

    • Identify co-evolving residue networks

    • Predict functional interactions based on evolutionary constraints

    • Validate predictions experimentally

When working with membrane proteins from hyperthermophiles, researchers must carefully optimize experimental conditions to maintain native interactions. This may include using specialized detergents, performing experiments at elevated temperatures, or employing membrane mimetics that preserve the structural integrity of protein complexes. The identification of interaction partners can provide valuable insights into the functional role of aq_1188 within the metabolic network of A. aeolicus .

What are the main technical challenges in working with recombinant proteins from hyperthermophiles, and how can they be addressed?

Working with proteins from hyperthermophiles like A. aeolicus presents unique challenges requiring specialized approaches:

Challenge 1: Expression System Limitations

  • Problem: Conventional expression systems operate at much lower temperatures than the native environment of hyperthermophilic proteins

  • Solution:

    • Use cold-shock promoters to improve expression at lower temperatures

    • Co-express molecular chaperones specific to thermophilic proteins

    • Consider thermophilic expression hosts for difficult proteins

    • Implement codon optimization for expression host preference

Challenge 2: Protein Folding and Solubility

  • Problem: Hyperthermophilic proteins may misfold or aggregate at mesophilic temperatures

  • Solution:

    • Express as fusion proteins with solubility-enhancing partners

    • Include chemical chaperones in expression and purification buffers

    • Perform on-column refolding during purification

    • Consider detergent screening for membrane proteins like aq_1188

Challenge 3: Activity Assessment

  • Problem: Standard assay conditions may not reveal activity of thermophilic enzymes

  • Solution:

    • Conduct assays at elevated temperatures (60-95°C)

    • Use thermostable assay components and buffers

    • Implement real-time monitoring to capture transient activity

    • Consider high-pressure systems to prevent buffer boiling

Challenge 4: Structural Characterization

  • Problem: Conventional structural biology techniques may be challenging for thermophilic membrane proteins

  • Solution:

    • Use thermostable detergents and lipid nanodiscs

    • Implement cryo-EM for membrane protein complexes

    • Consider solid-state NMR for membrane-embedded regions

    • Apply computational methods optimized for thermophilic proteins

These methodological adaptations are essential when working with recombinant aq_1188, as conventional protocols developed for mesophilic proteins often fail to account for the unique properties of proteins evolved for extreme thermophilic environments .

How can researchers distinguish between true structural features and artifacts when analyzing aq_1188?

Distinguishing genuine structural features from artifacts requires rigorous experimental design and validation:

Methodological Validation Framework:

  • Multiple Method Concordance

    • Compare results from orthogonal structural techniques

    • Assess agreement between computational predictions and experimental data

    • Require consistent observations across different sample preparations

  • Native vs. Recombinant Comparison

    • When possible, compare data from native A. aeolicus-derived protein

    • Assess impact of purification tags on structural properties

    • Evaluate effects of expression system on post-translational modifications

  • Environmental Condition Controls

    • Test structural properties across temperature range (25-95°C)

    • Evaluate pH-dependent structural changes

    • Assess effects of varied detergents and membrane mimetics

  • Mutational Validation

    • Design mutations predicted to disrupt observed structural features

    • Perform comparative structural analysis of mutants

    • Correlate structural changes with functional alterations

Common Artifacts and Solutions:

Artifact TypeDetection MethodMitigation Strategy
Misfolding due to expression systemCD spectroscopyOptimize expression conditions
Tag-induced structural changesCompare tagged and cleaved versionsUse cleavable tags or minimal tags
Detergent-induced conformational changeTest multiple detergent classesUse native-like lipid environments
Aggregation artifactsDynamic light scatteringOptimize buffer conditions

What are the recommended approaches for resolving contradictory experimental results when characterizing aq_1188?

Scientific investigation of uncharacterized proteins often yields apparently contradictory results. Resolving these contradictions requires systematic analysis:

Contradiction Resolution Protocol:

  • Methodological Source Analysis

    • Critically evaluate methodological differences between contradictory studies

    • Assess technical limitations of each approach

    • Determine if contradictions arise from different experimental conditions

  • Targeted Validation Experiments

    • Design experiments specifically addressing the contradiction

    • Control for variables that differ between contradictory studies

    • Implement orthogonal methods to provide independent evidence

  • Computational Integration

    • Develop models that potentially explain both sets of observations

    • Use simulation to test if contradictions reflect different functional states

    • Apply Bayesian analysis to weight evidence from different approaches

  • Systematic Hypotheses Testing

    • Formulate alternative hypotheses explaining the contradictions

    • Design critical experiments to distinguish between hypotheses

    • Implement decision tree approach to resolve complex contradictions

Case Example: Activity Contradictions
If one study reports aq_1188 has ion transport activity while another finds no such activity, researchers should systematically investigate:

  • Temperature differences in assay conditions

  • Lipid composition of test membranes

  • Protein preparation methods and potential denaturation

  • Assay sensitivity and detection limits

  • Potential requirement for co-factors or partner proteins

This methodological framework ensures that contradictions become opportunities for deeper understanding rather than obstacles to characterization. Given the extreme environmental adaptation of A. aeolicus proteins, contradictory results often reflect condition-dependent behaviors rather than experimental errors .

How might researchers leverage structural information about aq_1188 for biotechnological applications?

Proteins from hyperthermophiles offer unique properties that can be leveraged for biotechnology. For aq_1188, these potential applications include:

Biotechnology Application Framework:

  • Thermostable Biosensor Development

    • Characterize ligand binding properties of aq_1188

    • Engineer detection mechanisms coupled to binding events

    • Develop robust sensors for high-temperature industrial processes

    • Test performance in harsh chemical environments

  • Membrane Protein Engineering Platform

    • Identify thermostability determinants in aq_1188 structure

    • Transfer stability elements to mesophilic membrane proteins

    • Develop chimeric proteins with enhanced stability

    • Apply directed evolution to optimize engineered constructs

  • Drug Delivery System Components

    • Evaluate potential for controlled transport of therapeutic molecules

    • Engineer substrate specificity for targeted delivery

    • Develop temperature-responsive release mechanisms

    • Test incorporation into synthetic membrane systems

  • Biocatalysis Applications

    • Assess potential enzymatic activities under extreme conditions

    • Engineer catalytic capabilities based on structural information

    • Develop immobilization strategies for industrial use

    • Optimize reaction conditions for biotechnological processes

The extreme stability of proteins from A. aeolicus makes them valuable starting points for protein engineering efforts. The structural information gained from characterizing aq_1188 can inform rational design approaches for creating novel proteins with enhanced stability and specialized functions for industrial applications requiring resistance to extreme conditions .

What emerging technologies might accelerate the functional characterization of uncharacterized proteins like aq_1188?

Several cutting-edge technologies show promise for accelerating the characterization of proteins like aq_1188:

Emerging Technology Applications:

  • Advanced AI-Driven Structure Prediction

    • Apply AlphaFold2 and RoseTTAFold to generate high-confidence structural models

    • Implement new algorithms specialized for membrane proteins

    • Use predicted structures to guide experimental design

    • Develop AI systems for functional inference from structure

  • Single-Molecule Techniques

    • Apply FRET-based approaches to monitor conformational changes

    • Implement high-speed AFM for dynamic structural analysis

    • Utilize optical tweezers to study mechanistic properties

    • Develop single-molecule transport assays for membrane proteins

  • Microfluidic Systems for High-Throughput Analysis

    • Design parallelized functional screening platforms

    • Implement droplet-based assays for condition optimization

    • Develop integrated systems for expression, purification, and characterization

    • Create temperature-gradient platforms for thermophilic protein analysis

  • In Situ Structural Biology

    • Apply cryo-electron tomography for in-cell structural analysis

    • Implement integrative structural modeling approaches

    • Develop methods for membrane protein structural analysis in native membranes

    • Utilize correlative microscopy for structure-function relationships

These technologies can significantly reduce the time and resources required for characterizing uncharacterized proteins from organisms like A. aeolicus. The integration of computational prediction, high-throughput experimental approaches, and advanced structural characterization creates a powerful toolkit for tackling the challenges posed by proteins like aq_1188 .

How might comparative analysis across extremophiles enhance our understanding of aq_1188 function?

Comparative analysis across extremophiles provides valuable context for understanding specialized proteins like aq_1188:

Comparative Analysis Strategy:

  • Phylogenomic Profiling

    • Identify aq_1188 homologs across extremophile species

    • Construct phylogenetic trees to trace evolutionary history

    • Map sequence changes to environmental adaptations

    • Correlate conservation patterns with habitat characteristics

  • Structural Comparative Analysis

    • Compare predicted or determined structures across homologs

    • Identify conserved structural features despite sequence divergence

    • Analyze thermoadaptation mechanisms across temperature ranges

    • Map structural differences to functional specialization

  • Transcriptomic Meta-Analysis

    • Compare expression patterns across different extremophiles

    • Identify common regulatory mechanisms for homologous genes

    • Correlate expression with environmental stress responses

    • Develop models of functional conservation vs. specialization

  • Function Prediction Matrix

    • Create a feature matrix of known functions in distant homologs

    • Apply machine learning to predict functions in uncharacterized proteins

    • Test predictions with targeted experiments

    • Refine predictive models with experimental feedback

Comparative Analysis Table Example:

OrganismEnvironmentHomolog PresenceKey Sequence DifferencesPredicted Functional Adaptation
A. aeolicusHydrothermal vents (95°C)aq_1188Reference sequenceUnknown (target protein)
T. thermophilusHot springs (75°C)Hypothetical identifiedModified hydrophobic corePotential thermosensor
P. furiosusMarine hydrothermal (100°C)Distant homologAdditional disulfide bondsPossible metabolite transport
M. jannaschiiDeep-sea vents (85°C)Weak homologyAltered transmembrane regionsIon homeostasis role

By systematically comparing homologs across extremophiles adapted to different extreme environments, researchers can identify conserved features that suggest core functions versus adaptive modifications that indicate specialized roles. This comparative approach provides a powerful framework for generating testable hypotheses about the function of aq_1188 in the physiological context of A. aeolicus .

What integrated research approach would most efficiently elucidate the function of aq_1188?

Based on current understanding of A. aeolicus biology and the characteristics of aq_1188, the following integrated research approach is recommended:

Phase 1: Computational Analysis and Hypothesis Generation

  • Conduct comprehensive bioinformatic analysis of sequence and predicted structure

  • Identify potential functional domains and conserved motifs

  • Generate testable hypotheses based on structural features and genomic context

  • Design targeted experiments to address specific functional questions

Phase 2: Expression and Purification Optimization

  • Develop multiple expression constructs with various tags and fusion partners

  • Optimize conditions for high-yield, properly folded protein production

  • Establish purification protocols that maintain native conformation

  • Validate protein quality through biophysical characterization

Phase 3: Structural Characterization

  • Determine high-resolution structure through X-ray crystallography or cryo-EM

  • Validate structure with complementary techniques (CD, SAXS, HDX-MS)

  • Analyze membrane topology and lipid interactions

  • Identify potential ligand binding sites and catalytic regions

Phase 4: Functional Testing

  • Perform targeted assays based on structural features

  • Test interaction with metabolic pathway components

  • Evaluate membrane transport capabilities

  • Assess role in stress response and thermoadaptation

This integrated approach maximizes efficiency by generating well-founded hypotheses before experimental testing and ensures that technical challenges associated with an extremophilic membrane protein are addressed systematically. The framework is designed to adapt based on emerging results, allowing for course correction as new information becomes available .

What key experimental controls should researchers implement when studying aq_1188?

Rigorous experimental controls are essential for reliable characterization of uncharacterized proteins:

Essential Control Experiments:

  • Expression System Controls

    • Empty vector controls for expression studies

    • Host strain background controls for phenotypic analyses

    • Induction controls to normalize expression levels

    • Tag-only controls to account for tag-specific effects

  • Protein Quality Controls

    • Multiple biophysical methods to verify folding (CD, fluorescence, DSC)

    • Size exclusion chromatography to confirm monodispersity

    • Thermal stability assays at varied conditions

    • Activity retention tests after storage and handling

  • Functional Assay Controls

    • Positive controls using characterized homologous proteins

    • Negative controls with inactive mutants

    • Temperature controls spanning relevant ranges

    • Buffer composition controls to account for ion effects

  • Specificity Controls

    • Substrate panels including similar compounds

    • Competition assays to confirm binding specificity

    • Concentration-response relationships to confirm saturation

    • Mutational controls targeting predicted functional residues

Control Implementation Table:

Experiment TypeEssential ControlsImplementation ApproachData Validation Method
Protein-lipid interactionPure lipid systems without proteinParallel sample preparationStatistical comparison of multiple replicates
Transport assaysNon-functional mutant controlsSite-directed mutagenesis of key residuesActivity normalization to protein concentration
Thermal stabilityNative protein from A. aeolicus (if available)Side-by-side comparisonTm determination from multiple methods
Binding studiesStructurally similar non-ligandsCompetitive binding assaysScatchard analysis and specificity ratios

These controls ensure that observed results are specific to aq_1188 and not artifacts of the experimental system. For thermophilic proteins, temperature controls are particularly critical as activity and structural properties may vary dramatically across temperature ranges .

How should researchers prioritize different aspects of aq_1188 characterization based on available resources?

Resource allocation in protein characterization projects requires strategic prioritization:

Prioritization Framework:

  • Essential High-Priority Investigations

    • Basic biochemical characterization (size, oligomeric state, thermal stability)

    • Membrane topology determination

    • Identifying potential binding partners in A. aeolicus

    • Preliminary functional assays based on bioinformatic predictions

  • Important Secondary Priorities

    • High-resolution structural determination

    • Comprehensive mutagenesis studies

    • Detailed thermodynamic characterization

    • Expression studies under varied environmental conditions

  • Valuable Extended Characterization

    • Engineering applications development

    • Evolutionary analysis across multiple species

    • Integration into systems biology models

    • Advanced biophysical characterization

Resource Allocation Strategy:

Resource ConstraintRecommended ApproachAlternative MethodsExpected Outcomes
Limited fundingFocus on bioinformatics and basic biochemical characterizationCollaborate for advanced structural studiesFundamental functional understanding
Time constraintsPrioritize expression optimization and targeted functional assaysLeverage computational predictionsRapid functional hypothesis testing
Technical limitationsBegin with accessible techniques like CD and fluorescenceCollaborate for specialized methodsProgressive characterization building on accessible data
Expertise gapsFocus on areas of team strengthDevelop strategic collaborationsComplementary expertise utilization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.