Recombinant Aquifex aeolicus Uncharacterized protein aq_1428 (aq_1428)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Aquifex aeolicus Uncharacterized protein aq_1428 (aq_1428) is a protein derived from the hyperthermophilic bacterium Aquifex aeolicus. A. aeolicus thrives in high-temperature aquatic environments, such as hot springs, with optimal growth occurring between 85°C and 95°C . Many proteins from A. aeolicus are uncharacterized, and are identified via open reading frames (ORFs) .

Aq_328 as a Homolog

It is important to note that while there is no available information about Recombinant Aquifex aeolicus Uncharacterized protein aq_1428 (aq_1428), the protein Aq_328 is a close homolog, sharing many of the same characteristics.

Molecular Properties

Sedimentation equilibrium experiments indicate that Aq_328 exists as a monomer in solution, exhibiting an average sedimentation coefficient of 2.4 and an approximate molecular weight of 20 kDa . The protein's architecture comprises two noncanonical histone domains in tandem repeat within a single chain, resembling eukaryotic heterodimers (H2A/H2B and H3/H4) and archaeal histone heterodimers (HMfA/HMfB) .

Similarity to HMk

Aq_328 exhibits structural similarities to HMk, a histone-fold protein from the hyperthermophilic archaeon Methanopyrus kandleri . Despite differences in amino acid composition, conserved residues shared between Aq_328 and HMk may maintain the basic histone fold and potentially similar functions .

Potential Function

Structural similarities to DNA primase and cell division protein FtsK suggest that Aq_328 may be involved in DNA binding and function similarly to histone proteins . The A. aeolicus genome encodes a homolog of Aq_328, named Aq_616, which shares 25% sequence identity with Aq_328 . It is speculated that Aq_328 and Aq_616 may form a paired association, promoting the formation of higher oligomers required for DNA packing, similar to histone heterotetramers found in eukaryotes .

Thermostability

The high percentage of salt bridges observed in the structure of Aq_328 is considered a contributing factor to the protein's thermostability . Contact order is a major determinant of protein thermostability .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aq_1428; Uncharacterized protein aq_1428
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
aq_1428
Target Protein Sequence
MLRFEDWELAVVIILTRFMEAIAIIISIYLAFNGYKLRYVLATAGVFLLSVLINLTGLIF RPYFIYFSLASIFLSALILTALILYVKKNPEKTKSFSLPENARCPVCNVLILKEDELCTA KIGNYTYYFDTCHHLVQLLKEPDYFVERGNIFKGELKEVFVKTKDTKKWKKFSEVKLVGE DGRLVAYENPPKGAKVINPEEILRESPLS
Uniprot No.

Target Background

Database Links

KEGG: aae:aq_1428

STRING: 224324.aq_1428

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure and function of AQ_1428 protein from Aquifex aeolicus?

AQ_1428 is an uncharacterized protein from the extremophilic bacterium Aquifex aeolicus, a hyperthermophile that grows optimally at temperatures between 85-95°C. Bioinformatic analyses suggest it may belong to a novel class of thermostable proteins with potential enzymatic activity. Structural prediction algorithms indicate a possible globular domain with several conserved residues that might participate in substrate binding or catalysis. Functional analysis through sequence homology and structural modeling suggests potential roles in cellular metabolism or stress response, though experimental verification is required to confirm these predictions.

What expression systems are most effective for recombinant production of AQ_1428?

For thermostable proteins like AQ_1428, several expression systems have demonstrated efficacy with proper optimization. E. coli BL21(DE3) remains the primary expression system, particularly when coupled with appropriate chaperones to facilitate proper folding. For challenging expression scenarios, specialized strains like Rosetta-gami or ArcticExpress may improve yield. The addition of a hexahistidine tag at either the N- or C-terminus typically facilitates purification without compromising activity. Expression at lower temperatures (15-20°C) following induction, despite counterintuitive for a thermophilic protein, often improves solubility by slowing protein synthesis and allowing proper folding.

What are the optimal buffer conditions for maintaining AQ_1428 stability during purification?

Given AQ_1428's thermophilic origin, standard buffer optimization should consider thermal stability. Typically, HEPES or phosphate buffers (pH 7.0-8.0) containing 200-300 mM NaCl provide good starting conditions. Including 5-10% glycerol helps maintain stability during storage, while reducing agents like 1-5 mM DTT or β-mercaptoethanol may preserve any crucial cysteine residues. For long-term storage, maintaining the protein at 4°C is surprisingly more effective than freezing, which can disrupt the structural integrity of some thermostable proteins. Thermal shift assays should be performed to determine precise melting temperatures and optimize stabilizing conditions.

What protein purification strategies yield the highest purity and activity for recombinant AQ_1428?

Multi-step purification protocols typically yield the best results for AQ_1428. An effective strategy begins with immobilized metal affinity chromatography (IMAC) using Ni-NTA resin, exploiting the hexahistidine tag. This should be followed by size exclusion chromatography to separate potential aggregates and ensure homogeneity. For samples requiring exceptional purity, an intermediate ion exchange chromatography step may be beneficial. Heat treatment (75-80°C for 20-30 minutes) prior to chromatography can exploit AQ_1428's thermostability to eliminate heat-labile contaminant proteins, significantly simplifying downstream purification. Throughout purification, activity assays should be performed to track retention of functional properties.

How can isotope labeling of AQ_1428 be optimized for structural studies?

For NMR studies requiring isotope labeling, minimal media supplemented with 15N-ammonium chloride and/or 13C-glucose as sole nitrogen and carbon sources, respectively, provides the foundation for labeling. For E. coli expression systems, a stepwise adaptation to minimal media improves yield, beginning with rich media and gradually transitioning through 75%, 50%, and 25% rich media supplements. For deuteration, growth in D2O-based media requires extended adaptation periods, with incremental increases in D2O concentration from 50% to 100%. Selective amino acid labeling can be achieved by supplying specific labeled amino acids during a period of amino acid starvation induced before induction.

What crystallization conditions have proven successful for thermostable proteins similar to AQ_1428?

Crystallization of thermostable proteins like AQ_1428 often benefits from higher-than-standard temperatures during crystal growth (25-30°C). Initial screening should employ sparse matrix approaches, with particular attention to conditions containing sulfate, phosphate, or citrate as precipitants. PEG conditions in the molecular weight range of 3350-8000 Da often prove successful. Thermostable proteins frequently crystallize in moderate to high salt conditions (0.2-2.0 M), particularly with ammonium sulfate. Microseeding techniques can significantly improve crystal quality once initial crystallization conditions are identified. The addition of small-molecule ligands or inhibitors that might interact with the active site can stabilize protein conformation and improve crystallization success.

What enzymatic assays can be used to investigate potential catalytic functions of AQ_1428?

Without definitive functional annotation, a systematic screening approach is necessary. Initial screening should include common enzyme activities relevant to thermophilic bacteria, including hydrolase, transferase, and oxidoreductase activities. High-throughput colorimetric assays utilizing substrate libraries can identify potential activity. Thermal activity profiling, measuring enzyme activity across a temperature gradient (40-95°C), helps characterize optimal conditions. Activity-based protein profiling using mechanism-based probes can identify reactive sites. Differential scanning fluorimetry in the presence of potential substrates or cofactors can reveal binding interactions through thermal shift. Once preliminary activity is identified, detailed kinetic analysis should be performed to determine Km, kcat, and catalytic efficiency.

How can protein-protein interaction studies reveal AQ_1428's functional role in Aquifex aeolicus?

Multiple complementary approaches provide robust evidence of interaction partners. Pull-down assays using tagged AQ_1428 as bait, followed by mass spectrometry analysis of co-precipitated proteins from Aquifex aeolicus lysate, offer an unbiased screening method. Bacterial two-hybrid systems adapted for thermophilic proteins can verify specific interactions. Surface plasmon resonance provides quantitative binding kinetics for identified interaction candidates. Thermal co-aggregation assays, where potential partner proteins are mixed with AQ_1428 and gradually heated, can identify stabilizing interactions specific to thermophilic systems. For verification in vivo, proximity-dependent biotin identification (BioID) with a thermostable biotin ligase may be adapted for moderate thermophiles.

What computational methods are most effective for predicting AQ_1428 function?

Integrated computational approaches provide the most reliable functional predictions. Begin with advanced homology detection using profile hidden Markov models and position-specific scoring matrices to identify distant evolutionary relationships not detectable by standard BLAST searches. Structural prediction using AlphaFold2 or RoseTTAFold, followed by structural alignment against functional domains in databases like SCOP or CATH, can reveal structural similarities independent of sequence conservation. Genome context analysis, examining the genomic neighborhood of the aq_1428 gene, can reveal functional associations through operonic organization. Coexpression network analysis using transcriptomic data from various growth conditions may identify genes with similar expression patterns. Protein-protein interaction prediction through docking simulations with potential partners can generate testable hypotheses.

How can directed evolution approaches improve thermostability or alter substrate specificity of AQ_1428?

Directed evolution strategies for thermostable proteins like AQ_1428 require specialized approaches. Error-prone PCR with reduced mutation rates (1-2 mutations per gene) prevents excessive destabilization. Gene shuffling with related thermostable homologs preserves thermostability while introducing functional diversity. For screening, dual-selection systems that simultaneously assess function and thermostability are most effective. Thermostability can be screened through methods like colony survival after heat shock or by coupling protein function to reporter genes expressed after heat challenge. Stepwise selection with gradually increasing temperature provides evolutionary trajectories to enhanced thermostability. For altering substrate specificity, small targeted libraries focusing on active site residues identified through structural analysis offer higher success rates than random approaches.

What techniques are available for measuring protein thermostability parameters for AQ_1428?

Multiple complementary techniques provide comprehensive thermostability profiling. Differential scanning calorimetry measures direct heat absorption during thermal denaturation, providing thermodynamic parameters (ΔH, ΔS) and precise melting temperatures (Tm). Circular dichroism spectroscopy monitors secondary structure changes during thermal denaturation, particularly effective for α-helical content. Intrinsic fluorescence spectroscopy tracks tertiary structure changes through tryptophan emission shifts. Thermal shift assays (Thermofluor) using environment-sensitive dyes like SYPRO Orange offer high-throughput screening of stabilizing conditions. Limited proteolysis at increasing temperatures identifies flexible regions that unfold first. For functional thermostability, enzyme activity measurements across a temperature gradient provide Topt (temperature optimum) and thermal inactivation profiles. Half-life measurements at different temperatures enable calculation of activation energy for denaturation.

How does AQ_1428 compare to homologous proteins in other extremophilic organisms?

Comparative genomic analysis reveals the evolutionary context of AQ_1428. Sequence analysis across thermophilic species identifies conserved residues critical for thermostability versus those likely involved in function. Phylogenetic analysis places AQ_1428 in its evolutionary context, revealing whether it represents an ancient adaptation or more recent specialization. Comparison with homologs from organisms at different temperature optima (extreme thermophiles, moderate thermophiles, mesophiles) reveals temperature-dependent adaptation patterns. Structural comparison through homology modeling identifies conservation of folding patterns despite sequence divergence. Synteny analysis examining gene neighborhood conservation across species provides insights into functional context. Comparative biochemical analysis of recombinantly expressed homologs can reveal functional divergence or conservation across evolutionary distance.

What methodological approaches are recommended for comparing enzyme kinetics across temperature ranges?

Comparing enzyme kinetics across temperature ranges requires standardized methodology to generate meaningful data. Determine true initial velocity conditions at each temperature, as reaction rates accelerate at higher temperatures. Ensure substrate and cofactor stability at elevated temperatures through preliminary stability tests. Account for solubility changes of substrates and gases (especially oxygen) at different temperatures. For Arrhenius plot analysis, measure rates at minimum 5-7 different temperatures and confirm linearity. When comparing homologs from different thermal environments, standardize measurements both at the respective physiological temperatures and across the same temperature range. Calculate temperature coefficients (Q10) and activation energies (Ea) to quantify temperature dependence. Consider temperature effects on pH by using buffers with minimal temperature coefficients or adjusting pH for each temperature.

How can cryo-EM be optimized for structural determination of smaller proteins like AQ_1428?

Cryo-EM analysis of smaller proteins (<100 kDa) like AQ_1428 presents specific challenges requiring methodological adaptations. Utilizing Volta phase plates significantly enhances contrast for smaller proteins. Antibody fragment (Fab) labeling or fusion to protein scaffolds increases molecular size and provides fiducial markers. Expression of AQ_1428 as symmetric oligomers (dimers or higher) through genetic fusion to oligomerization domains can overcome size limitations. Grid preparation optimization is critical, with careful attention to ice thickness through controlled blotting times and glow discharge parameters. Data collection with energy filters and smaller pixel sizes improves signal-to-noise ratio. During image processing, optimize particle picking parameters for smaller targets and implement Bayesian approaches in reconstruction to address the reduced signal. Movie mode acquisition with higher frame rates minimizes beam-induced motion effects.

What strategies can address contradictory results between computational predictions and experimental data for AQ_1428?

Reconciling computational predictions with experimental results requires systematic troubleshooting. First, evaluate computational model confidence metrics and experimental data quality independently. Refine computational models with experimental constraints, incorporating any partial experimental data into improved predictions. Consider protein dynamics through molecular dynamics simulations, as static models may miss functional conformational changes. Experimental validation should target specific predictions with orthogonal methods. For structural discrepancies, consider whether crystal packing or experimental conditions might induce non-native conformations. If functional predictions conflict with experimental results, examine whether the protein requires cofactors, post-translational modifications, or interaction partners absent in experimental conditions. Cross-validate with intermediate approaches like hydrogen-deuterium exchange mass spectrometry that can bridge computational and traditional structural techniques.

How can AQ_1428 be engineered for potential biotechnological applications while maintaining thermostability?

Engineering AQ_1428 for biotechnological applications requires balanced approaches that enhance desired functions without compromising thermostability. Semi-rational design combining computational prediction with targeted libraries offers the most efficient strategy. Consensus design, introducing residues common in homologous thermostable proteins, can provide a stable engineering scaffold. Core stabilization through hydrophobic residue optimization or disulfide engineering creates a stable foundation for active site modifications. Active site redesign through computational enzyme design tools like Rosetta can identify mutations for novel activities. Stability and activity often trade off, necessitating compensatory stabilizing mutations when introducing activity-enhancing but potentially destabilizing mutations. Thermostability assessment after each engineering round ensures maintained thermal properties. Machine learning approaches integrating structure, dynamics, and evolutionary data can guide engineering by predicting mutations with high probability of success.

How can researchers troubleshoot low expression yields of recombinant AQ_1428?

Systematic troubleshooting of expression issues follows a logical progression. First, optimize codon usage for the expression host, particularly addressing rare codons. Evaluate fusion partners including solubility-enhancing tags (SUMO, MBP, TrxA) which often improve thermostable protein expression. Test multiple expression strains, particularly those designed for proteins with complex folding requirements. Optimize induction conditions through factorial design, testing temperature (15-30°C), inducer concentration, and induction time. For proteins prone to inclusion body formation, gentle solubilization using mild detergents or arginine may recover active protein. Co-expression with chaperones specific to thermophilic proteins, such as thermosome complexes, can improve folding. If intracellular proteolysis is suspected, include protease inhibitors and test protease-deficient strains. For secreted expression, ensure signal peptide compatibility and optimize periplasmic extraction conditions.

What are the best approaches for studying potential post-translational modifications in AQ_1428?

While less common in thermophilic bacteria, post-translational modifications may still be relevant for AQ_1428 function. Mass spectrometry provides the foundation for PTM analysis, with high-resolution MS/MS enabling precise localization and characterization. Enrichment strategies for specific modifications (phosphopeptide enrichment, glycopeptide capture) increase detection sensitivity. Multiple digestion strategies with different proteases improve sequence coverage. Top-down proteomics, analyzing intact proteins, preserves information about PTM combinations. For verification of specific modifications, site-directed mutagenesis of potentially modified residues followed by functional analysis can determine their significance. Native expression in Aquifex aeolicus followed by protein isolation enables comparison with recombinant systems to identify host-specific modifications. Targeted analysis should include thermophile-specific modifications such as methylation, which can enhance thermostability.

How might integrating AQ_1428 research with systems biology approaches provide new insights?

Systems biology integration elevates AQ_1428 research from isolated protein characterization to understanding its role within cellular networks. Multi-omics approaches combining transcriptomics, proteomics, and metabolomics data from Aquifex aeolicus under various conditions can place AQ_1428 in its functional context. Network analysis identifying proteins with correlated expression or physical interactions generates testable hypotheses about functional pathways. Flux balance analysis incorporating AQ_1428 into metabolic models can predict systemic effects of its activity. Comparative systems analysis between thermophilic and mesophilic organisms can reveal temperature-dependent network reorganization. Single-cell analyses adapted for extremophiles might reveal population heterogeneity in expression. Integrating structural data with systems-level information through structural systems biology approaches connects molecular mechanisms to cellular functions. These integrative approaches transform protein characterization from isolated study to understanding cellular roles in extreme environments.

What emerging technologies show promise for advancing research on thermostable proteins like AQ_1428?

Emerging technologies are revolutionizing thermostable protein research. Microfluidic systems for high-throughput screening at elevated temperatures enable rapid characterization of variant libraries. Advanced cryo-EM methods, particularly those employing machine learning for image processing, improve resolution for smaller proteins. Time-resolved structural methods including time-resolved crystallography and X-ray free electron laser (XFEL) techniques capture conformational dynamics relevant to function. Nanopore-based single-molecule protein analysis enables long-duration monitoring of individual protein molecules. Artificial intelligence approaches for protein design and function prediction, particularly those integrating evolutionary and structural data, accelerate hypothesis generation. Bioorthogonal chemistry for in vivo labeling and tracking of proteins provides insights into cellular localization and interactions. Cell-free expression systems adapted for thermophilic conditions enable rapid prototyping of variants. These technologies collectively expand our capabilities for understanding proteins from extreme environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.