Recombinant Aquifex aeolicus Uncharacterized protein aq_1446 (aq_1446)

Shipped with Ice Packs
In Stock

Description

General Information

FeatureDescription
Full NameRecombinant Full Length Aquifex Aeolicus Uncharacterized Protein Aq_1446 (Aq_1446)
SourceAquifex aeolicus
HostE. coli
TagHis-Tagged
Protein LengthFull Length (1-185)
Uniprot No.O67433
Immunogen SpeciesAquifex aeolicus (strain VF5)
Purity>85% (SDS-PAGE)
SourceMammalian cell
Protein LengthPartial
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, add 5-50% glycerol for long-term storage
Storage (Liquid)6 months at -20°C/-80°C
Storage (Lyophilized)12 months at -20°C/-80°C

Structure and Function

While the precise function of aq_1446 remains unknown, some research provides clues:

  • Structure: X-ray crystallography has been employed to determine the structures of hypothetical proteins from Aquifex aeolicus, revealing structural features and potential homologies with other proteins .

  • Potential function: Structure-based homology analysis has suggested possible molecular functions for some uncharacterized proteins, such as a potential link to metal-dependent proteinases .

Pathways and Interactions

Limited information is available regarding the specific pathways in which aq_1446 is involved. Some data suggests aq_1446 participates in several pathways and interacts directly with other proteins and molecules, as detected by methods like yeast two-hybrid assays, co-immunoprecipitation (co-IP), and pull-down assays .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
aq_1446; Uncharacterized protein aq_1446
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
aq_1446
Target Protein Sequence
MMKFLLILIFLASFSFSLTPEEEKQLLKDIAEIKTTLKAFIREADERFEQVDKRFEDVNR RFEDFNRRLNDLREDMNKRFELVDKRFIELREDMNKRFELVDQRFEQLYTFLWIITGIFT TLTASVIAFAWWDRRTIIRKTKEETFEEMEKELKPEKFRKIMNALREKAKTDKELEAILK KYGLL
Uniprot No.

Target Background

Database Links

KEGG: aae:aq_1446

STRING: 224324.aq_1446

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Aquifex aeolicus Uncharacterized protein aq_1446?

Recombinant Aquifex aeolicus Uncharacterized protein aq_1446 is a protein derived from the hyperthermophilic bacterium Aquifex aeolicus (strain VF5). The protein is classified as "uncharacterized," indicating that its precise biological function has not been fully elucidated. It is identified in the UniProt database with accession number O67433 and is typically produced through recombinant expression systems, most commonly using E. coli as the expression host . The recombinant form allows researchers to study this protein in isolation from its native environment, enabling detailed structural and functional analyses that would otherwise be challenging with proteins extracted directly from the thermophilic organism.

What are the optimal storage conditions for Recombinant Aquifex aeolicus Uncharacterized protein aq_1446?

The optimal storage conditions for Recombinant Aquifex aeolicus Uncharacterized protein aq_1446 are determined by its formulation and stability characteristics. For liquid formulations, the shelf life is typically 6 months when stored at -20°C/-80°C, while lyophilized forms can maintain stability for up to 12 months at the same temperature range . Repeated freezing and thawing should be avoided as this can compromise protein integrity and biological activity. For short-term storage of working solutions, aliquots can be maintained at 4°C for up to one week . To maximize stability during long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the default recommendation by suppliers) before aliquoting and storing at -20°C/-80°C .

How is Recombinant Aquifex aeolicus Uncharacterized protein aq_1446 typically reconstituted for experimental use?

For optimal reconstitution of Recombinant Aquifex aeolicus Uncharacterized protein aq_1446, the following methodological approach is recommended: First, briefly centrifuge the vial containing the lyophilized protein to ensure all material is collected at the bottom of the container . The protein should then be reconstituted using deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL . For long-term storage of the reconstituted protein, addition of glycerol to a final concentration of 5-50% is advised, with the manufacturer's default recommendation being 50% . This glycerol addition helps prevent damage from freeze-thaw cycles and maintains protein stability. The reconstituted protein should be aliquoted before storage at -20°C/-80°C to minimize the need for repeated freeze-thaw cycles, which can significantly degrade protein quality and functional activity .

How should I design a controlled experiment to characterize the function of Recombinant Aquifex aeolicus Uncharacterized protein aq_1446?

Designing a controlled experiment to characterize the function of Recombinant Aquifex aeolicus Uncharacterized protein aq_1446 requires a systematic approach following core experimental design principles. Begin by clearly defining your variables: the independent variable would be the presence, concentration, or specific modification of the aq_1446 protein, while dependent variables might include binding affinity, enzymatic activity, or structural changes under various conditions . Formulate a specific, testable hypothesis based on bioinformatic predictions or homology to characterized proteins from related organisms .

Design experimental treatments that manipulate the independent variable systematically—for example, testing protein activity across a range of temperatures (relevant given the thermophilic nature of Aquifex aeolicus), pH levels, or substrate concentrations . Include appropriate controls such as heat-inactivated protein, structurally similar proteins with known functions, or reaction mixtures lacking the protein entirely .

For robust characterization, employ a between-subjects design comparing different treatment conditions or a within-subjects design measuring the same parameters under varying conditions . Plan your measurements carefully, utilizing techniques appropriate for the hypothesized function—such as spectrophotometric assays for enzymatic activity, circular dichroism for structural analysis, or interaction studies using techniques like isothermal titration calorimetry or surface plasmon resonance .

What controls should be included when studying potential enzymatic activities of aq_1446?

Positive controls should incorporate well-characterized enzymes with activities similar to those hypothesized for aq_1446, preferably from related thermophilic organisms with comparable optimal temperature ranges . These provide validation of assay conditions and a reference point for relative activity levels. Furthermore, include substrate-specificity controls using structurally related substrates to determine selectivity and mechanism .

Time-dependent controls are crucial to establish reaction kinetics and distinguish enzymatic activities from non-specific effects. Temperature and pH controls are particularly important given the extremophilic origin of the protein, so assays should be conducted across ranges that encompass both mesophilic and thermophilic conditions . Finally, metal ion and cofactor dependency should be assessed by including EDTA controls and selective addition of potential cofactors, as many enzymes from extremophiles have specific metal requirements for activity .

How can I evaluate whether the protein tag affects the function of aq_1446 in my experimental setup?

Evaluating the potential influence of protein tags on the function of Recombinant Aquifex aeolicus Uncharacterized protein aq_1446 requires a methodical comparative approach. Begin by designing parallel experiments using both tagged and tag-removed versions of the protein . The datasheet indicates that "tag type will be determined during the manufacturing process," suggesting variability in the tagging strategy . Therefore, obtaining or producing the protein with a cleavable tag system is advisable.

First, compare basic biochemical parameters between tagged and untagged versions, including solubility profiles, thermal stability using differential scanning fluorimetry, and structural integrity through circular dichroism or limited proteolysis . These analyses provide foundational evidence of whether the tag fundamentally alters protein characteristics.

For functional assessment, conduct activity assays with both protein versions under identical conditions, measuring parameters relevant to your hypothesized function (e.g., substrate conversion rates, binding affinities, or interaction profiles) . Statistical analysis should be employed to determine if differences between tagged and untagged versions are significant.

Additionally, perform tag position experiments if possible, comparing N-terminal versus C-terminal tags to identify position-dependent effects . For a more sophisticated analysis, conduct molecular dynamics simulations to predict tag-protein interactions that might affect active sites or binding interfaces . Finally, include controls with different tag types (His, GST, MBP) if feasible, as tag chemistry can differentially impact protein behavior . This comprehensive approach ensures that observed functions can be confidently attributed to the native protein rather than tag-induced artifacts.

What structural characterization methods are most appropriate for analyzing Recombinant Aquifex aeolicus Uncharacterized protein aq_1446?

The structural characterization of Recombinant Aquifex aeolicus Uncharacterized protein aq_1446 requires a multi-technique approach to elucidate its three-dimensional conformation and functional domains. Given that aq_1446 is derived from a hyperthermophilic organism, special consideration must be given to techniques that can accommodate thermostable proteins, which often possess unique structural features contributing to their stability .

Primary structure analysis should begin with mass spectrometry techniques, particularly liquid chromatography-mass spectrometry (LC-MS/MS), to confirm sequence identity and identify any post-translational modifications or processing events. For secondary structure determination, circular dichroism (CD) spectroscopy provides valuable information about the protein's α-helical, β-sheet, and random coil content under various temperature and pH conditions—particularly relevant given the thermophilic origin of the protein .

For tertiary structure analysis, X-ray crystallography remains the gold standard, though crystallization of thermostable proteins can present unique challenges requiring specialized screens incorporating higher salt concentrations and temperatures reflecting the native environment . Nuclear magnetic resonance (NMR) spectroscopy offers an alternative approach for solution-state structural analysis if crystallization proves difficult, especially for determining dynamic regions or conformational changes upon ligand binding .

How can I assess the thermal stability of aq_1446 and compare it to mesophilic homologs?

Assessing the thermal stability of Recombinant Aquifex aeolicus Uncharacterized protein aq_1446 and comparing it to mesophilic homologs requires a systematic approach involving multiple complementary techniques. Given that Aquifex aeolicus is a hyperthermophilic bacterium, aq_1446 likely possesses enhanced thermal stability compared to mesophilic counterparts .

The primary method for quantitative thermal stability assessment is differential scanning calorimetry (DSC), which measures the heat capacity of the protein as a function of temperature, providing precise melting temperature (Tm) values for both aq_1446 and selected mesophilic homologs . Differential scanning fluorimetry (DSF) using SYPRO Orange or similar dyes offers a higher-throughput alternative, monitoring protein unfolding through increased fluorescence as hydrophobic residues become exposed during thermal denaturation .

For functional thermal stability, design activity assays (if the protein's function has been determined or can be predicted) performed at incrementally increasing temperatures, plotting relative activity versus temperature to create thermal activity profiles for both aq_1446 and mesophilic variants . Circular dichroism (CD) spectroscopy with temperature ramping provides insights into secondary structure changes during thermal denaturation, revealing whether unfolding occurs cooperatively or through intermediate states .

To understand the molecular basis of thermal stability differences, conduct comparative analysis using the following table format:

Stability Parameteraq_1446Mesophilic Homolog 1Mesophilic Homolog 2
Melting temperature (Tm)[°C][°C][°C]
Temperature for 50% activity loss[°C][°C][°C]
Half-life at 80°C[minutes][minutes][minutes]
Ionic bond density[bonds/residue][bonds/residue][bonds/residue]
Hydrophobic core residues[%][%][%]
Proline content in loops[count][count][count]

This multifaceted approach provides comprehensive insights into the thermal stability characteristics of aq_1446 relative to its mesophilic counterparts, highlighting structural features that may contribute to its thermostability .

What bioinformatic approaches can help predict the potential function of aq_1446 prior to experimental validation?

Predicting the potential function of Recombinant Aquifex aeolicus Uncharacterized protein aq_1446 through bioinformatic approaches requires an integrated computational strategy that leverages various predictive tools. Begin with sequence-based analysis using BLAST against multiple databases (UniProt, PDB, COG) to identify homologous proteins with known functions, paying particular attention to those from other thermophilic organisms that might share adaptations to extreme environments .

Next, conduct domain and motif analysis using InterProScan, SMART, and Pfam to identify conserved functional domains, active site signatures, or binding motifs that might suggest enzymatic or binding activities . Given that sequence similarity can be low between functionally related thermophilic proteins, structure-based approaches are particularly valuable. Employ protein structure prediction tools such as AlphaFold2 or RoseTTAFold to generate a three-dimensional model of aq_1446 . The predicted structure can be compared against structural databases using DALI or TM-align to identify structurally similar proteins regardless of sequence conservation.

For more sophisticated function prediction, implement active site recognition methods such as 3DLigandSite or COACH to identify potential ligand-binding pockets or catalytic residues based on the predicted structure . Molecular docking simulations with metabolites from thermophilic pathways can further refine functional hypotheses. Additionally, genomic context analysis examining the organization of genes surrounding aq_1446 in the Aquifex aeolicus genome can provide insights into potential metabolic pathways or functional relationships .

To systematically evaluate the confidence of functional predictions, create a consensus scoring approach that integrates results from multiple methods:

Prediction MethodPredicted FunctionConfidence Score (1-5)Supporting Evidence
Sequence homology[function][score][evidence]
Domain prediction[function][score][evidence]
Structure comparison[function][score][evidence]
Active site analysis[function][score][evidence]
Genomic context[function][score][evidence]
Combined consensus[function][score][evidence]

This integrated bioinformatic approach provides a robust foundation for generating specific functional hypotheses that can be prioritized for subsequent experimental validation .

How might post-translational modifications differ between native and recombinant forms of aq_1446?

The post-translational modification (PTM) profile of Recombinant Aquifex aeolicus Uncharacterized protein aq_1446 likely differs significantly between its native form in A. aeolicus and recombinant versions produced in heterologous expression systems. These differences stem from the distinct cellular machinery and environmental conditions between the hyperthermophilic native host and typical expression systems such as E. coli .

In its native A. aeolicus environment, aq_1446 may undergo thermophile-specific modifications that enhance protein stability at extreme temperatures (80-95°C). These could include atypical disulfide bond formation, unusual glycosylation patterns, or specialized methylation that aren't replicated in mesophilic expression hosts . The recombinant form of aq_1446 from E. coli expression systems (as indicated in the product datasheet) lacks eukaryotic PTM machinery entirely, meaning any native glycosylation, phosphorylation, or lipidation requiring specialized enzymes would be absent .

The differences in redox environment between expression systems also significantly impact PTM profiles. E. coli cytoplasm has a reducing environment that may prevent disulfide bond formation that might naturally occur in the A. aeolicus cellular context . Additionally, specialized PTMs that contribute to thermostability, such as unusual amino acid modifications or metal ion coordination sites, may not be properly established in recombinant systems .

To comprehensively assess these differences, researchers should employ a comparative proteomic approach:

Post-translational ModificationDetection MethodNative aq_1446 (predicted)Recombinant aq_1446 (E. coli)Recombinant aq_1446 (Yeast)
Disulfide bondsNon-reducing SDS-PAGE[Pattern][Pattern][Pattern]
PhosphorylationPhospho-specific staining/MS[Sites][Sites][Sites]
GlycosylationGlyco-specific staining/MS[Pattern]Minimal or absent[Pattern]
Methylation/AcetylationPTM-specific antibodies/MS[Sites][Sites][Sites]
Metal coordinationICP-MS analysis[Metals][Metals][Metals]

Understanding these differences is crucial when interpreting functional studies, as lacking native PTMs may significantly alter the protein's activity, stability, or interaction profile in experimental settings .

What approaches can be used to identify potential binding partners or substrates of aq_1446?

Identifying potential binding partners or substrates of Recombinant Aquifex aeolicus Uncharacterized protein aq_1446 requires a multi-faceted approach combining in vitro biochemical methods, in vivo techniques, and computational predictions tailored to the challenges of a thermophilic protein of unknown function .

For unbiased partner identification, affinity purification coupled with mass spectrometry (AP-MS) represents a powerful approach. Immobilize purified aq_1446 on an appropriate matrix (considering its tag type ) and incubate with cell lysates from A. aeolicus or related thermophiles under varying temperature and buffer conditions that mimic the native environment . Bound proteins can be eluted and identified using high-resolution mass spectrometry, with appropriate controls including heat-denatured aq_1446 and an irrelevant thermostable protein to filter out non-specific interactions .

For substrate identification, activity-based protein profiling (ABPP) can be employed if functional predictions suggest enzymatic activity. This approach uses active site-directed probes to capture and identify substrates . Alternatively, metabolite profiling using techniques such as differential metabolomics comparing wild-type and aq_1446-expressing cells can reveal accumulated or depleted metabolites suggesting substrate relationships .

Protein microarrays provide another high-throughput approach, where aq_1446 can be screened against arrays of potential binding partners including proteins, nucleic acids, lipids, or small molecules . For in vivo validation, bacterial two-hybrid systems adapted for thermophilic proteins or proximity-dependent biotin identification (BioID) modified for thermostable enzymes can confirm interactions within cellular contexts .

Computational approaches complement these experimental methods. Molecular docking simulations using predicted structures of aq_1446 can screen libraries of potential small molecule substrates or protein partners . Co-evolution analysis examining patterns of coordinated mutations across protein families can predict functional associations between aq_1446 and other proteins .

The results from these various approaches can be organized and prioritized using a scoring matrix:

Potential Partner/SubstrateIdentification MethodBinding/Activity ScoreRelevance to Thermophilic BiologyValidation Status
[Candidate 1][Method][Score][Relevance][Status]
[Candidate 2][Method][Score][Relevance][Status]
[Candidate 3][Method][Score][Relevance][Status]

This systematic approach ensures comprehensive exploration of the potential interactome and functional substrates of aq_1446, establishing a foundation for detailed mechanistic studies .

How can I address the challenges of protein crystallization for structural studies of aq_1446?

Addressing the challenges of protein crystallization for structural studies of Recombinant Aquifex aeolicus Uncharacterized protein aq_1446 requires specialized strategies that account for the unique properties of thermostable proteins. The crystallization of proteins from thermophilic organisms presents both advantages and challenges compared to mesophilic proteins .

Begin with an optimization of the protein sample itself. Since the recombinant protein has >85% purity by SDS-PAGE according to the product datasheet , further purification to >95% homogeneity using techniques such as ion exchange or size exclusion chromatography may be necessary for crystallization success. Consider employing limited proteolysis to identify stable core domains if the full-length protein proves recalcitrant to crystallization .

For thermostable proteins like aq_1446, screening crystallization conditions at elevated temperatures (30-45°C) rather than the standard 4-20°C can better mimic the native folding environment and potentially improve crystallization outcomes . Additionally, specialized crystallization screens for thermostable proteins incorporating higher salt concentrations, different precipitants, and pH ranges relevant to thermophilic environments should be utilized .

The protein tag mentioned in the datasheet may interfere with crystallization. Consider testing both tagged and tag-cleaved versions of the protein, as tags can sometimes facilitate crystal contacts but more often hinder ordered packing . Surface entropy reduction (SER) is another valuable approach, where surface patches of high entropy residues (Lys, Glu) are mutated to residues with lower conformational entropy (Ala), potentially creating new crystal contacts .

If obtaining well-diffracting crystals remains challenging, alternative crystallization methods should be explored:

Crystallization ApproachImplementation StrategyAdvantages for Thermostable ProteinsSuccess Metrics
Standard vapor diffusionScreen at 4°C, 20°C, and 37°CBaseline approachCrystal size, diffraction resolution
Lipidic cubic phaseFor membrane-associated proteinsStabilizes hydrophobic interfacesPhase separation, crystal formation
MicroseedingUse crushed microcrystals as nucleation sitesOvercomes nucleation barriersImproved crystal morphology
Counter-diffusionCapillary-based gradient formationSlower, more ordered growthCrystal quality improvement
In situ proteolysisAdd trace protease to crystallization dropRemoves flexible regions during crystallizationAppearance of new crystal forms
Thermal cyclingAlternating temperature during growthExploits thermostability for improved packingReduced nucleation, larger crystals

For cases where traditional crystallization fails despite extensive optimization, consider alternative structural biology approaches such as cryo-electron microscopy (especially if aq_1446 forms larger assemblies) or solution NMR for smaller domains . This systematic approach maximizes the chances of successful structural determination of this challenging thermostable uncharacterized protein.

How might studying aq_1446 contribute to our understanding of protein adaptation to extreme environments?

Studying Recombinant Aquifex aeolicus Uncharacterized protein aq_1446 offers a unique window into protein adaptation mechanisms in extreme environments, particularly hyperthermophilic conditions. Aquifex aeolicus thrives at temperatures between 85-95°C, representing one of the most thermophilic bacterial species known . Comprehensive characterization of aq_1446 can reveal fundamental principles of protein thermostability that extend beyond individual proteins to broader evolutionary adaptations.

Structural analysis of aq_1446 may uncover specialized stabilizing features such as increased ionic interactions, more extensive hydrophobic cores, or reduced surface loop flexibility compared to mesophilic homologs . These findings would contribute to the growing database of thermostable protein features, potentially revealing novel stabilization mechanisms specific to Aquifex lineage proteins . Comparative analysis between aq_1446 and identified mesophilic homologs can highlight specific amino acid substitutions or structural elements that confer thermostability, providing insights into the minimal modifications required for adaptation to extreme temperatures .

The uncharacterized nature of aq_1446 presents an opportunity to potentially discover novel functional adaptations. If functional characterization reveals enzymatic activity, studying its kinetic parameters across temperature ranges could demonstrate how catalytic efficiency, substrate specificity, and allosteric regulation have adapted to extreme conditions . This might reveal unique temperature-dependent conformational changes or active site architectures that maintain functionality at temperatures that typically denature most proteins .

From an evolutionary perspective, phylogenetic analysis incorporating aq_1446 can help reconstruct the trajectory of protein adaptation in the Aquificae lineage, which occupies one of the deepest branches in the bacterial phylogenetic tree . This provides insights into ancient adaptation mechanisms that emerged early in bacterial evolution. Additionally, understanding the functional role of aq_1446 may shed light on metabolic pathways unique to hyperthermophiles, potentially revealing novel biochemical strategies for energy production or stress response in extreme environments .

The translational potential of this research extends to biotechnological applications, where identified thermostabilizing features could inform protein engineering efforts to create heat-resistant enzymes for industrial processes . The fundamental knowledge gained from studying aq_1446 thus bridges basic science questions about life's adaptation to extreme environments with practical applications in biotechnology and synthetic biology.

What are the methodological considerations for comparing the biochemical properties of aq_1446 across different temperature ranges?

Comparing the biochemical properties of Recombinant Aquifex aeolicus Uncharacterized protein aq_1446 across different temperature ranges requires specialized methodological approaches that account for both the thermophilic origin of the protein and the technical challenges of high-temperature biochemistry . A comprehensive experimental design must incorporate temperature as a central variable while maintaining consistent measurement conditions for valid comparisons.

For activity assays, specialized temperature-controlled spectrophotometers or plate readers capable of precise temperature regulation from ambient to 95°C are essential . Buffer systems must be carefully selected to maintain consistent pH across temperature ranges, as pH of many common buffers varies significantly with temperature. Phosphate buffers with temperature coefficients of -0.0028 to -0.0018 ΔpH/°C may be preferable for their relatively stable pH profiles . Additionally, solvent evaporation and degassing at higher temperatures must be controlled through sealed reaction vessels or mineral oil overlays to prevent concentration changes during measurements .

Stability measurements require particular attention to methodology. Thermal shift assays using differential scanning fluorimetry need modified protocols for proteins already stable at high temperatures, including higher starting temperatures and extended temperature ranges . For structural analyses across temperatures, techniques such as variable-temperature circular dichroism or solution NMR with temperature ramping can reveal temperature-dependent conformational changes .

For kinetic analyses, determining temperature effects on substrate binding, catalytic rates, and product release requires measuring reaction progress at multiple time points across the temperature gradient. The Arrhenius plot analysis (plotting ln(k) versus 1/T) can reveal changes in reaction mechanisms across temperature ranges, with deviations from linearity indicating temperature-dependent shifts in rate-limiting steps .

A standardized method for presenting temperature-dependent biochemical data should include a template like the following:

Biochemical ParameterMeasurement Method25°C40°C55°C70°C85°CActivation Energy (kJ/mol)
Enzymatic activity[Assay type][Value][Value][Value][Value][Value][Calculated Ea]
Substrate affinity (Km)[Method][Value][Value][Value][Value][Value]N/A
Structural stability (Tm)[Method]N/AN/A[Value][Value][Value]N/A
Protein-protein interactions[Method][Value][Value][Value][Value][Value][Calculated Ea]

This methodical approach enables rigorous comparison of biochemical properties across temperature ranges, revealing how aq_1446 has adapted to function optimally in extreme thermal environments and providing insights into thermophilic protein biochemistry principles .

How can computational modeling inform hypotheses about aq_1446 function in the context of Aquifex aeolicus metabolism?

Computational modeling provides powerful tools for generating hypotheses about the function of Recombinant Aquifex aeolicus Uncharacterized protein aq_1446 within the broader metabolic context of this hyperthermophilic organism. A comprehensive computational approach integrates structural prediction, metabolic network analysis, and evolutionary information to position aq_1446 within the unique biochemical landscape of A. aeolicus .

Begin with advanced structural prediction using tools like AlphaFold2 or RoseTTAFold, which can generate high-confidence models even for proteins with limited homology to known structures . The predicted structure can be analyzed for potential binding pockets or catalytic sites using computational tools such as CASTp or SiteMap, which identify surface cavities and assess their physicochemical properties . Molecular dynamics simulations at elevated temperatures (80-95°C) can provide insights into the structural stability and dynamic behavior of aq_1446 under native-like conditions, potentially revealing temperature-dependent conformational changes relevant to function .

Integrating the aq_1446 structural model with the reconstructed metabolic network of Aquifex aeolicus enables contextual analysis of potential functions. Genome-scale metabolic modeling can identify metabolic gaps where enzymatic functions are computationally predicted but not assigned to specific genes, providing candidate functions for aq_1446 . Flux balance analysis incorporating thermodynamic constraints specific to hyperthermophilic growth conditions can predict metabolic pathways likely to be active in A. aeolicus and identify potential roles for uncharacterized proteins .

Comparative genomics approaches provide evolutionary context for functional prediction. Analysis of gene neighborhood conservation across related thermophilic species can reveal consistent genomic clustering patterns suggesting functional relationships . Phylogenetic profiling, examining the co-occurrence of aq_1446 homologs with other genes across bacterial genomes, can identify proteins with correlated evolutionary histories, suggesting functional associations .

The integration of these computational approaches can be summarized in a functional hypothesis matrix:

Computational ApproachFunctional PredictionConfidence Score (1-5)Supporting EvidenceTestable Hypothesis
Structural prediction[Function][Score][Evidence][Hypothesis]
Active site analysis[Function][Score][Evidence][Hypothesis]
Metabolic gap analysis[Function][Score][Evidence][Hypothesis]
Gene neighborhood[Function][Score][Evidence][Hypothesis]
Phylogenetic profiling[Function][Score][Evidence][Hypothesis]
Integrated consensus[Function][Score][Evidence][Hypothesis]

This computational modeling framework generates testable hypotheses about aq_1446 function that can guide experimental design, prioritize biochemical assays, and contextualize the role of this uncharacterized protein within the extreme metabolic adaptations of Aquifex aeolicus .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.