Recombinant Aquifex aeolicus Uncharacterized protein aq_1466 (aq_1466)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aq_1466; Uncharacterized protein aq_1466
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
aq_1466
Target Protein Sequence
MGLNMARKENLVHVLVALILSLSIWFVVNFGERLPLDIVRFVEIQGKREGYVYRVEPQTV DITLIVSRRFLESKLLERVRAIIYVFELKEGTHRVRVDVVSPLPYFIQPVAVNPYYVNVT VIKEKR
Uniprot No.

Target Background

Database Links

KEGG: aae:aq_1466

STRING: 224324.aq_1466

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Aquifex aeolicus and why is it significant for protein research?

Aquifex aeolicus is a hyperthermophilic, chemolithoautotrophic, hydrogen-oxidizing, and microaerophilic bacterium that thrives at extremely high temperatures, specifically around 85°C. This organism has attracted significant research interest due to its position as one of the earliest diverging bacterial lineages and its ability to grow in extreme conditions. The proteins from thermophilic organisms like A. aeolicus are particularly valuable for structural biology studies because they typically exhibit enhanced stability, making them easier to crystallize and analyze through various structural determination methods. Additionally, A. aeolicus has been shown to grow on an H2/S medium and produce H2S from sulfur during the later exponential growth phase, indicating its specialized metabolic capabilities.

The study of proteins from extremophile organisms like A. aeolicus provides insights into molecular adaptations that enable protein functionality under extreme conditions. Furthermore, many enzymes from thermophiles have industrial applications due to their inherent stability at high temperatures, which can be advantageous in various biotechnological processes. Thus, understanding uncharacterized proteins like Aq_1466 may reveal novel biological functions and potential biotechnological applications.

How does Aq_1466 relate to other characterized proteins in Aquifex aeolicus?

While direct information about Aq_1466's relationship to other characterized A. aeolicus proteins is limited in the provided search results, contextual understanding of this organism's proteome can provide some insights. A. aeolicus possesses several well-characterized membrane-bound multienzyme complexes, particularly those involved in hydrogen oxidation and sulfur reduction pathways.

For instance, A. aeolicus contains a membrane-bound multiprotein complex that carries sulfur reducing activity, which includes a [NiFe] hydrogenase and a sulfur reductase connected via quinones. This complex is encoded by an operon previously annotated as dms (dimethyl sulfoxide reductase) but renamed as sre. While there's no direct evidence linking Aq_1466 to this complex based on the provided search results, the presence of hydrophobic regions in Aq_1466's sequence suggests it could potentially interact with membrane-bound protein complexes or serve ancillary functions in membrane-associated metabolic pathways.

Comparative genomic analyses would be necessary to establish potential functional relationships between Aq_1466 and other A. aeolicus proteins. Such analyses might reveal conserved domains, potential protein-protein interaction sites, or gene clustering patterns that could provide clues to Aq_1466's functional role within the organism's cellular machinery.

What are the optimal expression conditions for recombinant Aq_1466 protein in E. coli?

The expression of thermophilic proteins in mesophilic hosts like E. coli presents unique challenges due to differences in codon usage, protein folding machinery, and potential toxicity. For recombinant Aq_1466, the following protocol elements should be considered:

  • Vector selection: Vectors with the T7 promoter system (such as pET series) are often optimal for thermostable protein expression.

  • E. coli strain: BL21(DE3) or its derivatives like Rosetta(DE3) for rare codon accommodation are commonly used for thermophilic protein expression.

  • Growth temperature: Lower induction temperatures (15-25°C) often improve the solubility of thermophilic proteins despite their native high-temperature functionality.

  • Induction conditions: Using lower IPTG concentrations (0.1-0.5 mM) and longer induction times (overnight).

  • Media supplementation: Addition of osmolytes such as betaine (2 mM) and sorbitol (1 M) can improve protein folding.

What purification strategies are most effective for obtaining high-purity Aq_1466?

Since the recombinant Aq_1466 protein contains an N-terminal His-tag, immobilized metal affinity chromatography (IMAC) serves as the primary purification method. For optimal purification results, consider the following comprehensive approach:

  • Cell lysis optimization: For membrane-associated proteins like Aq_1466, the lysis buffer should contain appropriate detergents (such as n-dodecyl β-D-maltoside or CHAPS) to solubilize the protein effectively from membranes.

  • IMAC purification:

    • Using Ni-NTA or Co-NTA columns

    • Washing with increasing imidazole concentrations (10-30 mM) to remove non-specifically bound proteins

    • Elution with higher imidazole concentrations (250-500 mM)

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates and achieve higher purity

    • Ion exchange chromatography as needed for charged contaminant removal

  • Quality control: SDS-PAGE analysis confirms the purity is greater than 90% for the commercially available preparation.

For researchers requiring ultra-pure protein for structural studies, additional purification steps may be necessary. It's worth noting that thermostable proteins offer the advantage of heat treatment as a purification step (incubation at 70-80°C for 10-20 minutes), which can denature most E. coli proteins while leaving the thermostable target protein intact.

How should researchers properly store and reconstitute Aq_1466 for maximum stability and activity?

Based on the information provided for the commercially available Aq_1466 protein, the following storage and reconstitution protocols are recommended:

For long-term storage:

  • The protein is supplied as a lyophilized powder.

  • Store the lyophilized protein at -20°C/-80°C upon receipt.

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles, which can compromise protein integrity.

For reconstitution:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom.

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (50% is recommended) to prevent freezing damage and maintain protein stability during storage.

  • Store working aliquots at 4°C for up to one week.

For thermostable proteins like those from A. aeolicus, it's important to note that while they are stable at high temperatures, they may still be susceptible to other forms of degradation such as oxidation or proteolysis. Therefore, addition of reducing agents (like DTT or β-mercaptoethanol at 1-5 mM) and/or protease inhibitors may be beneficial for certain applications, especially when working with the protein for extended periods at ambient temperatures.

What techniques are most appropriate for determining the structure of Aq_1466?

Determining the structure of an uncharacterized protein like Aq_1466 requires a strategic approach, especially given its potential membrane association. The following methodologies are recommended:

Each technique has strengths and limitations, and a multi-technique approach often yields the most comprehensive structural information. Given Aq_1466's thermophilic origin, structural studies at various temperatures (including elevated temperatures near A. aeolicus's growth optimum of 85°C) could provide insights into temperature-dependent conformational changes.

How can researchers investigate the function of uncharacterized proteins like Aq_1466?

Investigating the function of uncharacterized proteins like Aq_1466 requires a multi-faceted approach combining bioinformatics, biochemical assays, and genetic techniques:

Based on the limited information about Aq_1466, a reasonable starting hypothesis might be that it functions in membrane processes related to A. aeolicus's unique metabolism, potentially in sulfur/hydrogen pathways or in maintaining membrane integrity at high temperatures. Testing for interactions with known components of these pathways could be an informative first step.

What approaches can be used to study Aq_1466 interactions with other proteins and molecules?

Understanding protein-protein and protein-ligand interactions is crucial for elucidating the function of uncharacterized proteins like Aq_1466. For membrane-associated proteins from thermophilic organisms, specialized approaches are required:

  • Co-immunoprecipitation (Co-IP):

    • Using anti-His antibodies to pull down His-tagged Aq_1466 along with interacting proteins

    • Analysis of interacting partners via mass spectrometry

    • Requires crosslinking optimization for membrane proteins

  • Bacterial Two-Hybrid System:

    • Particularly useful for membrane proteins when modified versions like BACTH (Bacterial Adenylate Cyclase Two-Hybrid) are used

    • Can screen libraries of A. aeolicus proteins for interactions

  • Proximity Labeling:

    • Using BioID or APEX2 fusions to Aq_1466 to identify neighboring proteins in vivo

    • Especially valuable for transient interactions

  • Microscale Thermophoresis (MST):

    • Label-free technique for measuring binding affinities

    • Suitable for membrane proteins in detergent micelles

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Identifies regions involved in protein-protein interactions

    • Can be performed under varying temperature conditions to mimic native environment

  • Isothermal Titration Calorimetry (ITC):

    • For quantitative measurement of binding thermodynamics

    • Requires significant optimization for membrane proteins

  • Native Mass Spectrometry:

    • Emerging technique for analyzing intact membrane protein complexes

    • Provides stoichiometry and complex stability information

For thermophilic membrane proteins like Aq_1466, it's essential to consider the temperature at which interaction studies are conducted. While room temperature experiments are convenient, interactions that occur at A. aeolicus's growth temperature (85°C) may not be detected under standard conditions. Therefore, performing experiments at elevated temperatures or using thermostable detection systems is advisable for capturing physiologically relevant interactions.

What are common challenges in working with Aq_1466 and how can they be addressed?

Working with proteins from hyperthermophilic organisms like A. aeolicus presents unique challenges, particularly for an uncharacterized membrane-associated protein like Aq_1466:

  • Expression and Solubility Issues:

    • Challenge: Low expression levels or inclusion body formation

    • Solution: Optimize codon usage, lower induction temperature (15-20°C), use specialized strains (C41/C43), employ fusion tags (SUMO, MBP), or add chemical chaperones (betaine, sorbitol)

  • Membrane Protein Extraction:

    • Challenge: Inefficient extraction from membranes

    • Solution: Screen multiple detergents (DDM, LMNG, CHAPS) at various concentrations; consider alternative solubilization methods like SMALPs (styrene-maleic acid lipid particles)

  • Protein Stability:

    • Challenge: Protein instability during purification and storage

    • Solution: Include glycerol (20-50%), optimize buffer composition (pH, salt concentration), add specific lipids that might be required for stability

  • Functionality Assessment:

    • Challenge: Lack of known function makes activity assays difficult to design

    • Solution: Employ thermal shift assays to identify potential ligands, use broad substrate screening approaches, consider computational prediction of binding partners

  • Structural Analysis:

    • Challenge: Difficulty obtaining crystals for structural determination

    • Solution: Use alternative approaches like Cryo-EM, NMR (for specific domains), or in silico modeling; optimize crystallization by screening various detergents and lipids

For specific Aq_1466 handling issues, the provided information indicates that repeated freeze-thaw cycles should be avoided, and working aliquots should be stored at 4°C for up to one week. This suggests that the protein may be susceptible to structural changes or aggregation upon repeated freezing and thawing.

How can researchers differentiate between functional and non-functional conformations of Aq_1466?

Distinguishing functional from non-functional conformations of an uncharacterized protein presents a significant challenge. For Aq_1466, researchers can employ the following approaches:

  • Thermal Stability Assays:

    • Differential Scanning Fluorimetry (DSF) or Thermofluor assays to monitor protein unfolding

    • Comparison of thermal denaturation curves under various conditions (pH, salt, potential ligands)

    • Proper folding often correlates with increased thermal stability

  • Spectroscopic Analysis:

    • Circular Dichroism (CD) spectroscopy to assess secondary structure content

    • Fluorescence spectroscopy to monitor tertiary structure (intrinsic tryptophan fluorescence)

    • These methods can track temperature-dependent conformational changes

  • Size-Exclusion Chromatography (SEC):

    • Analyze oligomeric state and aggregation propensity

    • SEC coupled with Multi-Angle Light Scattering (SEC-MALS) provides absolute molecular weight

    • Properly folded protein typically shows a monodisperse peak

  • Limited Proteolysis:

    • Well-folded proteins show resistance to proteolytic digestion

    • Comparing digestion patterns under different conditions can identify stable conformations

  • Activity Correlation:

    • If potential functions can be tested, correlate activity with physical parameters

    • For membrane proteins, reconstitution in liposomes might be necessary to restore function

For Aq_1466 specifically, it's important to consider that its native environment is at 85°C. Therefore, what might appear as an "unfolded" state at lower temperatures could potentially be the functional state at the organism's growth temperature. Designing experiments that account for this temperature-dependent behavior is crucial for accurate functional assessment.

What analytical techniques are most suitable for studying the thermostability of Aq_1466?

Given that Aq_1466 comes from a hyperthermophilic organism that grows at 85°C, its thermostability properties are of particular interest. The following analytical techniques are recommended for comprehensive thermostability analysis:

  • Differential Scanning Calorimetry (DSC):

    • Directly measures heat absorbed during protein unfolding

    • Provides thermodynamic parameters (ΔH, ΔCp)

    • Can detect multiple unfolding transitions

    • Optimal for determining precise melting temperatures (Tm)

  • Thermal Shift Assays (TSA)/Differential Scanning Fluorimetry (DSF):

    • Uses fluorescent dyes (SYPRO Orange) that bind to exposed hydrophobic regions during unfolding

    • High-throughput method suitable for screening stability conditions

    • Can be performed in real-time PCR instruments

  • Circular Dichroism (CD) with Temperature Ramping:

    • Monitors changes in secondary structure during thermal denaturation

    • Particularly informative for α-helical membrane proteins

    • Can be performed at multiple wavelengths for detailed structural analysis

  • Dynamic Light Scattering (DLS) with Temperature Control:

    • Monitors protein aggregation as temperature increases

    • Provides information on colloidal stability

    • Can detect subtle pre-aggregation changes

  • Activity Measurements at Various Temperatures:

    • If any enzymatic or binding activity can be established, measuring its temperature dependence

    • Particularly valuable for determining the optimum temperature for function

For Aq_1466, a comparative thermostability analysis against mesophilic homologs (if identified) could provide insights into adaptations that enable function at high temperatures. Additionally, investigating the effects of different buffer conditions, particularly the presence of specific ions or cofactors, might reveal factors that contribute to the protein's thermostability in its native environment.

How can researchers interpret contradictory data when studying Aq_1466?

When studying uncharacterized proteins like Aq_1466, researchers may encounter seemingly contradictory data. Resolving these contradictions requires systematic investigation and careful consideration of experimental conditions. Here's a methodological approach to address such discrepancies:

  • Reconcile Differences in Experimental Conditions:

    • Temperature effects: Results obtained at different temperatures may vary significantly for thermophilic proteins. A systematic temperature-dependent analysis may resolve apparent contradictions.

    • Buffer composition: Minor differences in pH, salt concentration, or the presence of specific ions can dramatically affect protein behavior.

    • Protein concentration: Concentration-dependent effects (such as oligomerization) may lead to different observations at varying protein concentrations.

  • Consider Post-Translational Modifications:

    • Recombinant Aq_1466 produced in E. coli may lack native post-translational modifications present in A. aeolicus.

    • Different expression systems might yield proteins with varying modifications.

  • Evaluate Protein Conformation State:

    • Membrane proteins often exist in multiple conformational states.

    • Different detergents or lipid environments can stabilize different conformations.

    • Native-like lipid composition may be critical for proper function.

  • Assess Experimental Technique Limitations:

    • Each analytical technique has inherent biases and limitations.

    • Cross-validation using complementary techniques can help resolve contradictions.

    • For instance, contradictions between crystallographic and solution-based studies might reflect crystal packing artifacts.

  • Statistical Analysis and Reproducibility:

    • Employ rigorous statistical methods to determine significance of observations.

    • Ensure adequate replication to distinguish random variation from true biological phenomena.

  • Computational Validation:

    • Molecular dynamics simulations can help interpret contradictory experimental results.

    • In silico docking or modeling studies may provide theoretical context for unexpected observations.

When encountering contradictory data specifically for Aq_1466, researchers should carefully consider the protein's thermophilic origin and potential membrane association. Experiments performed at temperatures far below the organism's growth optimum (85°C) may not accurately reflect native behavior. Similarly, the protein's interaction with membrane components may be critical for its proper structure and function.

What are the most promising applications for Aq_1466 in biotechnology and structural biology?

Despite being uncharacterized, proteins like Aq_1466 from extremophilic organisms hold significant potential for various applications:

  • Thermostable Protein Engineering Platform:

    • Thermostable proteins serve as excellent scaffolds for protein engineering.

    • Understanding Aq_1466's structural features that confer thermostability could inform the design of other thermostable proteins for industrial applications.

    • If functional characterization reveals enzymatic activity, Aq_1466 could be developed into a heat-resistant biocatalyst.

  • Membrane Protein Structural Biology Model:

    • Thermostable membrane proteins often exhibit enhanced stability during purification and crystallization.

    • Aq_1466 could serve as a model system for developing improved methods for membrane protein structure determination.

    • Insights gained could advance our ability to study more challenging membrane proteins from mesophilic organisms.

  • Extremophile Adaptation Studies:

    • Comparative analysis with homologs from mesophilic organisms could reveal molecular mechanisms of thermal adaptation.

    • Such insights contribute to our fundamental understanding of protein evolution and adaptation to extreme environments.

  • Potential Therapeutic Target Discovery Platform:

    • If Aq_1466 homologs exist in pathogenic bacteria, structural and functional insights could inform antimicrobial drug development.

    • Thermostable proteins with novel functions might inspire the design of stable therapeutic proteins.

  • Nanotechnology Applications:

    • Thermostable proteins can be incorporated into nanomaterials for applications requiring high-temperature stability.

    • If Aq_1466 forms stable complexes or structures, these might be exploited in bionanotechnology.

The remarkable ability of A. aeolicus to thrive at 85°C and its unique metabolic capabilities, such as hydrogen oxidation and sulfur reduction, suggest that proteins like Aq_1466 may possess unique properties with significant biotechnological potential. Detailed structural and functional characterization will be essential to realize these applications.

How might comparative genomics advance our understanding of Aq_1466 and related proteins?

Comparative genomics represents a powerful approach to gain insights into uncharacterized proteins like Aq_1466, particularly when experimental data is limited:

  • Evolutionary Conservation Analysis:

    • Identifying orthologs across different species can reveal conserved regions likely important for function.

    • Conservation patterns across thermophiles versus mesophiles can highlight thermostability-conferring features.

    • Analysis of selection pressure (dN/dS ratios) can identify functionally constrained residues.

  • Genomic Context Analysis:

    • Examining neighboring genes can provide functional clues through "guilt by association."

    • In prokaryotes like A. aeolicus, genes involved in related processes are often clustered in operons.

    • Conserved gene neighborhoods across species can strengthen functional predictions.

  • Phylogenetic Profiling:

    • Correlating the presence/absence of Aq_1466 with specific metabolic pathways or environmental adaptations.

    • Co-occurrence patterns with other genes can suggest functional relationships.

    • This is particularly valuable for proteins from early-branching bacteria like Aquifex.

  • Domain Architecture Analysis:

    • Identifying conserved domains or motifs shared with characterized proteins.

    • Detecting unique domain combinations that might indicate novel functions.

    • Tracking domain gain/loss events during evolution.

  • Structural Bioinformatics Integration:

    • Mapping sequence conservation onto predicted or experimental structures.

    • Identifying structural features unique to thermophilic homologs.

    • Structure-guided sequence analysis to identify potential functional sites.

For Aq_1466 specifically, comparative analysis with proteins involved in the known membrane-bound multienzyme complexes in A. aeolicus might reveal functional relationships. Given A. aeolicus's position as an early-branching bacterial lineage, comparative genomic analyses could also provide insights into the evolution of protein function in ancient metabolic pathways.

What experimental approaches could determine if Aq_1466 plays a role in A. aeolicus's unique thermophilic metabolism?

A. aeolicus possesses a distinctive hydrogen-oxidizing, sulfur-reducing metabolism that functions at extremely high temperatures. Determining whether Aq_1466 participates in these unique metabolic pathways requires a multi-faceted experimental strategy:

  • Protein Localization Studies:

    • Immunogold electron microscopy using antibodies against Aq_1466

    • Membrane fractionation followed by Western blot analysis

    • These approaches could determine if Aq_1466 co-localizes with known components of hydrogen oxidation or sulfur reduction pathways

  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation with known components of the membrane-bound multienzyme complexes

    • Crosslinking studies followed by mass spectrometry

    • Bacterial two-hybrid screening against A. aeolicus protein libraries

    • These methods could identify direct interaction partners that suggest functional roles

  • Metabolic Impact Assessment:

    • If genetic manipulation of A. aeolicus is feasible, creating knockout or knockdown strains

    • Heterologous expression in related thermophilic bacteria with gene deletion complementation

    • Metabolomic analysis comparing wild-type and modified strains

    • These approaches could directly assess the impact of Aq_1466 on metabolic pathways

  • Biochemical Activity Assays:

    • Reconstitution of Aq_1466 with components of the hydrogen-oxidizing or sulfur-reducing complexes

    • Testing for enhancement or inhibition of enzymatic activities

    • Assays conducted at physiologically relevant temperatures (85°C)

    • These experiments could reveal functional contributions to known metabolic processes

  • Transcriptional Response Analysis:

    • RNA-seq to determine if Aq_1466 expression correlates with genes involved in hydrogen/sulfur metabolism

    • Examining expression changes under different growth conditions (varying hydrogen or sulfur availability)

    • These studies could establish regulatory relationships with known metabolic pathways

The membrane-bound multienzyme complex in A. aeolicus that couples hydrogen oxidation and sulfur reduction represents a unique system for energy conservation. Determining whether Aq_1466 is a component of this complex or plays an ancillary role would significantly advance our understanding of this uncharacterized protein's function.

What are the key considerations for researchers working with Aq_1466?

Researchers working with the uncharacterized protein Aq_1466 from Aquifex aeolicus should consider several critical factors to ensure successful experimental outcomes:

  • Temperature Considerations: Always remember that A. aeolicus is a hyperthermophile growing optimally at 85°C. While recombinant Aq_1466 can be handled at lower temperatures for many procedures, functional studies should include experiments at elevated temperatures that better reflect the protein's native environment.

  • Membrane Association: The amino acid sequence suggests Aq_1466 may be membrane-associated. This has profound implications for experimental design, including the need for appropriate detergents during purification, potential reconstitution into membrane mimetics for functional studies, and consideration of lipid interactions.

  • Appropriate Controls: When working with an uncharacterized protein, include both positive and negative controls in all experiments. For structural and stability studies, consider using well-characterized thermostable proteins as benchmarks.

  • Multidisciplinary Approach: Combine bioinformatic predictions with experimental validation. For uncharacterized proteins, computational analyses can provide valuable hypotheses about function that guide experimental design.

  • Storage and Handling: Follow recommended protocols for storage (lyophilized at -20°C/-80°C) and reconstitution (in deionized water with 5-50% glycerol). Avoid repeated freeze-thaw cycles and store working aliquots at 4°C for no more than one week.

  • Contextual Understanding: Consider Aq_1466 in the broader context of A. aeolicus biology, particularly its unique hydrogen-oxidizing and sulfur-reducing metabolic capabilities. This contextual framework can provide valuable clues about potential functions.

By addressing these key considerations, researchers can maximize their chances of making meaningful discoveries about this fascinating protein from an extremophilic organism, potentially revealing new insights into protein thermostability, membrane protein function, and early bacterial metabolism.

How should researchers integrate computational and experimental approaches when studying Aq_1466?

Effective integration of computational and experimental approaches is essential for studying uncharacterized proteins like Aq_1466, creating a synergistic research workflow:

  • Initial Computational Analysis:

    • Begin with sequence-based predictions (secondary structure, transmembrane domains, functional domains)

    • Perform homology searches to identify potential functional homologs

    • Use AlphaFold2 or similar tools to generate structural predictions

    • These analyses generate testable hypotheses about structure and function

  • Targeted Experimental Validation:

    • Design experiments to test specific computational predictions

    • For instance, if transmembrane domains are predicted, perform membrane association assays

    • If binding pockets are identified, design biochemical binding assays for predicted ligands

    • These experiments provide validation or refinement of computational models

  • Iterative Refinement Cycle:

    • Use experimental results to refine computational models

    • Updated models generate new hypotheses for experimental testing

    • This iterative approach progressively builds a more accurate understanding

  • Integrated Structural Analysis:

    • Combine experimental structural data (X-ray, NMR, Cryo-EM) with computational models

    • Use computational methods to fill gaps in experimental data

    • Molecular dynamics simulations can extend static experimental structures to dynamic models

    • This integration yields more complete structural information

  • Functional Prediction Validation:

    • Test computationally predicted functions with biochemical assays

    • Use site-directed mutagenesis to probe the importance of predicted functional residues

    • Employ docking studies to identify potential interaction partners for experimental validation

    • This approach efficiently focuses experimental efforts on likely functions

For Aq_1466 specifically, computational predictions of its potential role in the membrane-bound hydrogen-oxidizing and sulfur-reducing pathways of A. aeolicus could guide the design of specific interaction studies or activity assays. The integration of computational and experimental approaches is particularly valuable for uncharacterized proteins from extremophiles, where traditional experimental approaches may be challenging due to the extreme conditions required for native function.

What are the broader implications of understanding proteins like Aq_1466 from extremophilic organisms?

Research on uncharacterized proteins like Aq_1466 from extremophiles extends beyond basic science to impact multiple fields:

  • Evolutionary Biology Insights:

    • A. aeolicus represents one of the earliest diverging bacterial lineages

    • Understanding its proteins provides glimpses into ancient metabolic pathways

    • Comparing thermophilic proteins with mesophilic homologs reveals evolutionary adaptations to extreme environments

    • These insights contribute to our understanding of life's early evolution and adaptation mechanisms

  • Astrobiology and Origin of Life Research:

    • Thermophilic organisms are considered potential models for early life forms

    • Proteins functioning at high temperatures may resemble primordial proteins in the early Earth's hot environments

    • This research contributes to hypotheses about the conditions under which life emerged

    • Understanding thermostable proteins informs the search for potential biosignatures on other planets

  • Biotechnological Applications:

    • Thermostable proteins have numerous industrial applications due to their stability at high temperatures

    • Novel enzymes from extremophiles often possess unique catalytic properties

    • Understanding the molecular basis of thermostability enables the engineering of mesophilic proteins for enhanced stability

    • These applications span biofuel production, food processing, and pharmaceutical manufacturing

  • Structural Biology Advancements:

    • Thermostable proteins often serve as excellent model systems for structural studies

    • Methodological advances in studying these proteins can be applied to more challenging mesophilic proteins

    • The unique properties of extremophilic proteins continue to expand our understanding of protein structure-function relationships

  • Climate Change Adaptation Research:

    • Understanding how proteins adapt to extreme conditions provides insights relevant to predicting biological responses to climate change

    • Molecular mechanisms of thermal adaptation may inform conservation biology and agricultural adaptation strategies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.