Recombinant Aquifex aeolicus Uncharacterized protein aq_1793 (aq_1793)

Shipped with Ice Packs
In Stock

Description

Introduction to Aquifex aeolicus and Protein aq_1793

Aquifex aeolicus is a remarkable hyperthermophilic bacterium that represents one of the earliest diverging lineages in bacterial evolution. This chemolithoautotrophic, Gram-negative, motile organism thrives in water temperatures between 85°C and 95°C, making it one of the most thermophilic eubacteria described to date . Found primarily near underwater volcanoes and hot springs, including the Aeolic Islands north of Sicily (from which it derives its name) and Yellowstone National Park, this bacterium has adapted to survive in extreme environments that would be lethal to most organisms .

The name "Aquifex" literally means "water-maker," reflecting the organism's ability to produce water by oxidizing hydrogen gas . Morphologically, A. aeolicus cells are rod-shaped with dimensions of approximately 2.0-6.0μm in length and 0.4-0.5μm in diameter . These cells are motile through monopolar polytrichous flagella and often form large conglomerations of up to 100 individual cells . A distinctive characteristic of this bacterium is its ability to thrive under microaerophilic conditions, utilizing hydrogen, oxygen, and mineral salts as primary energy sources .

The genome of A. aeolicus has been fully sequenced, making it the first thermophilic bacterium to achieve this milestone . Its genome consists of a circular chromosome containing 1,551,335 base pairs with a G+C content of 43.4%, and it encodes 1,796 genes . Interestingly, this genome is only about one-third the size of the Escherichia coli genome, demonstrating the compact genetic architecture often observed in organisms adapted to extreme environments .

The study of proteins from extremophiles like A. aeolicus holds significant value for understanding fundamental biological processes and potentially discovering novel enzymatic activities that function under extreme conditions. These proteins often exhibit remarkable stability at high temperatures, making them valuable candidates for industrial and biotechnological applications requiring thermostable components.

Production and Recombinant Expression

The production of recombinant Aquifex aeolicus uncharacterized protein aq_1793 involves several sophisticated biotechnological processes to ensure high yield, purity, and functional integrity. The primary method for generating this protein for research applications involves heterologous expression in Escherichia coli, a widely used host for recombinant protein production .

The process begins with the cloning of the aq_1793 gene into an appropriate expression vector. For commercial preparations, the gene is typically engineered to include an N-terminal histidine (His) tag, which facilitates subsequent purification steps . This genetic construct is then transformed into E. coli cells, which serve as factories for protein production. Following transformation, the bacterial culture is grown under controlled conditions and protein expression is induced.

After sufficient growth and expression, the bacterial cells are harvested and lysed to release the recombinant protein. The His-tagged aq_1793 protein is then purified from the cell lysate using affinity chromatography, typically with nickel-chelating resin that specifically binds the histidine tag . This purification approach allows for the selective capture of the target protein from the complex mixture of cellular components.

Following initial purification, additional chromatographic steps may be employed to achieve higher purity. Quality control assessments, including SDS-PAGE analysis, confirm that the purified protein meets the specified purity standards, which for commercial preparations is typically greater than 90% . The final product is then formulated in an appropriate buffer system to maintain stability.

Table 2. Production and Storage Specifications of Recombinant aq_1793 Protein

ParameterSpecification
Expression SystemE. coli
TagN-terminal His tag
FormLyophilized powder
Purity>90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Storage-20°C/-80°C
Working Storage4°C for up to one week
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)
Long-term StorageAddition of 5-50% glycerol recommended (default 50%)

For long-term storage, the purified protein is often lyophilized or stored in solution with cryoprotectants such as glycerol . The lyophilization process removes water while preserving the protein's structure, resulting in a stable powder form that can be reconstituted when needed. Storage recommendations typically specify keeping the protein at -20°C or -80°C to prevent degradation, with working aliquots maintained at 4°C for up to one week .

When reconstituting the lyophilized protein, it is recommended to centrifuge the vial briefly to ensure all the protein is at the bottom of the container . The protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and for long-term storage, the addition of 5-50% glycerol (final concentration) is recommended . Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity .

The storage buffer for the protein typically consists of a Tris/PBS-based solution containing 6% trehalose at pH 8.0 . Trehalose, a non-reducing disaccharide, serves as a stabilizing agent that helps maintain protein structure during storage and freeze-thaw cycles. This formulation is designed to optimize the stability and shelf-life of the recombinant protein.

The successful recombinant expression and purification of aq_1793 provide researchers with a valuable tool for investigating the properties and potential functions of this uncharacterized protein from an extremophilic organism. The availability of purified protein facilitates various analytical techniques, including structural studies, biochemical assays, and interaction analyses.

Functional Analysis and Potential Roles

Despite its classification as an "uncharacterized" protein, several approaches can be employed to gain insights into the potential functions of aq_1793. An integrated analysis of its sequence characteristics, the biology of Aquifex aeolicus, and comparative studies with other proteins provides a framework for developing hypotheses about its biological role.

The predominance of hydrophobic amino acids in the aq_1793 sequence strongly indicates a membrane-associated function . Membrane proteins in bacteria serve diverse critical roles, including nutrient transport, signal transduction, energy generation, and maintaining cellular homeostasis. In the context of A. aeolicus, which thrives in extreme environments, specialized membrane functions are particularly important for survival under high-temperature conditions.

The hyperthermophilic nature of A. aeolicus necessitates extraordinary adaptations in its proteins to maintain functional integrity at temperatures approaching 95°C . Proteins must resist denaturation while remaining sufficiently flexible to perform their biological functions. The membrane environment itself presents unique challenges at high temperatures, including increased fluidity and permeability. Membrane proteins like aq_1793 may play crucial roles in maintaining membrane stability and function under these extreme conditions.

While direct experimental evidence for the function of aq_1793 is limited, examining the biology of A. aeolicus provides valuable context. This organism possesses specialized metabolic pathways for energy conservation under extreme conditions, including three distinct [NiFe] hydrogenases that are thought to be involved in energy conservation and CO₂ fixation . As a chemolithoautotroph, A. aeolicus obtains carbon by fixing CO₂ and uses hydrogen as an electron/energy source . If aq_1793 is indeed a membrane protein, it might participate in these specialized metabolic processes, potentially in gas exchange, ion transport, or redox reactions across the membrane.

The ability of A. aeolicus to thrive in microaerophilic environments with oxygen concentrations as low as 7.5ppm suggests sophisticated mechanisms for oxygen sensing and utilization . Membrane proteins often play key roles in these processes, and aq_1793 could potentially be involved in oxygen transport or sensing. Additionally, the organism's adaptation to sulfur-rich volcanic environments suggests it may possess specialized membrane proteins for sulfur compound transport or metabolism.

Insights from other characterized A. aeolicus proteins can also inform hypotheses about aq_1793. For example, aspartate transcarbamoylase (ATCase) from A. aeolicus demonstrates remarkable efficiency in utilizing unstable carbamoyl phosphate at elevated temperatures, with substrate affinities 30-40 fold higher than the corresponding E. coli enzyme . This illustrates how A. aeolicus proteins can be highly specialized for function under extreme conditions, suggesting that aq_1793 may similarly possess unique adaptations for its functional role.

Another uncharacterized conserved protein from A. aeolicus has been structurally characterized (PDB ID: 2YZS) and assigned a potential enzymatic function (EC: 3.1) . This exemplifies how structural studies can provide important functional insights for proteins of unknown function and suggests a similar approach could be fruitful for aq_1793.

The absence of a definitively assigned function for aq_1793 highlights both the challenges and opportunities in studying proteins from extremophiles. While its precise biological role remains to be elucidated, continued investigation using complementary approaches—including structural determination, genetic studies, biochemical assays, and computational analyses—holds promise for revealing novel functions that may expand our understanding of life in extreme environments.

Research Applications and Biotechnological Potential

The recombinant Aquifex aeolicus uncharacterized protein aq_1793 presents significant opportunities for both fundamental research and practical applications. Its origin from a hyperthermophilic organism confers unique properties that make it particularly valuable in various scientific and biotechnological contexts.

In basic research, aq_1793 serves as an important model for understanding protein adaptation to extreme environments. Studying how proteins maintain structural integrity and functional activity at temperatures approaching 95°C provides valuable insights into the fundamental principles of protein folding, stability, and evolution . As A. aeolicus represents one of the earliest diverging bacterial lineages, analysis of its proteins, including aq_1793, may offer glimpses into ancient protein architectures and functions, contributing to our understanding of early life on Earth .

The membrane-associated nature of aq_1793, as suggested by its amino acid composition, makes it particularly relevant for research on membrane protein biology in extremophiles . Membrane proteins are notoriously challenging to study due to their hydrophobic nature and complex folding requirements, yet they constitute approximately 30% of all proteins and represent targets for a majority of therapeutic drugs. The study of thermostable membrane proteins like aq_1793 may inform strategies for stabilizing other membrane proteins for structural and functional studies.

From a biotechnological perspective, proteins from hyperthermophiles offer several compelling advantages for industrial applications. Processes conducted at higher temperatures can benefit from increased reaction rates, reduced risk of microbial contamination, improved substrate solubility, and decreased viscosity of reaction media. While the specific enzymatic activity of aq_1793 remains to be characterized, its apparent membrane association suggests potential applications in:

  1. Biosensor development, where thermostable membrane proteins could serve as recognition elements in high-temperature sensing applications.

  2. Bioremediation processes targeting pollutants in hot industrial effluents or geothermal environments.

  3. Biofuel cell technologies, where thermostable proteins from A. aeolicus have already shown promise as alternatives to chemical catalysts .

  4. Membrane protein engineering, using aq_1793 as a scaffold for designing novel membrane-associated functions with enhanced thermostability.

The commercial availability of recombinant aq_1793 facilitates its use in various research applications. Scientists can employ the purified protein in biochemical characterization studies, structural analyses, or protein engineering efforts. The protein may also serve as an antigen for antibody production, enabling the development of immunological tools for detecting and studying aq_1793 in its native context.

Other proteins from A. aeolicus provide precedents for biotechnological applications. For instance, the aspartate transcarbamoylase from A. aeolicus demonstrates exceptional efficiency in substrate utilization at elevated temperatures, illustrating how proteins from this organism can be specialized for extreme conditions . The organism's hydrogenases have been identified as promising components for biofuel cell applications due to their stability under high temperature and low oxygen conditions .

Future research directions for aq_1793 might include:

  1. Structural determination through X-ray crystallography, nuclear magnetic resonance spectroscopy, or cryo-electron microscopy to elucidate its three-dimensional organization.

  2. Functional characterization through biochemical assays, genetic studies, or protein-protein interaction analyses to identify its biological role.

  3. Comparative analyses with homologous proteins from mesophilic organisms to understand the molecular basis of thermostability.

  4. Protein engineering studies to enhance or modify its properties for specific biotechnological applications.

The uncharacterized nature of aq_1793 represents not a limitation but an opportunity for discovery, potentially revealing novel biochemical functions that could expand our understanding of extremophile biology and open new avenues for biotechnological innovation.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
aq_1793; Uncharacterized protein aq_1793
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
aq_1793
Target Protein Sequence
MMSPMASILMYTHFRMWKHALNVWSITLFQNFRLTAELIILFTLLNFLFLIPVMNVFAFF IHNVVNFSLIIYFSKLYLKVKGNEEEYKREIERTKLAQALKTYLPHAVTLTFATYAMTVA YLILLFVSLLILGLITGITVFTFGTDFIIAYLIFIVLLLILYFWIITSYPVFFARTVIEG QTPRDFFFLFLTAPFSKLLWKLAFSLEVLFSSFVIGFFSLFIFLFQFVMSHLFPPLFFLT YFVAFSNTLLIYLFGVISVSYLLWKREGK
Uniprot No.

Target Background

Database Links

KEGG: aae:aq_1793

STRING: 224324.aq_1793

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of Aquifex aeolicus protein aq_1793?

The protein aq_1793 is a hypothetical protein encoded in the Aquifex aeolicus VF5 complete genome. Genomic analysis reveals that aq_1793 is located at position 1265940..1266749 on the negative strand, with a length of 269 amino acids. The gene has a notably low GC content of 36.42% (considerably below the genome average), with a standard deviation of -1 from the mean GC content, potentially indicating horizontal gene transfer or specialized function . The protein is flanked by the ntrC2 gene (encoding an NtrC family transcriptional regulator) upstream and a gene encoding another hypothetical protein (aq_1794) downstream, suggesting possible functional relationships within this genomic neighborhood .

What structural features characterize aq_1793?

While aq_1793 specifically lacks resolved structural data, researchers can draw insights from other uncharacterized Aquifex aeolicus proteins that have been crystallized. Crystal structures of similar uncharacterized proteins from this organism have been determined using X-ray crystallography, providing templates for homology modeling . Comparative structural analysis indicates that many uncharacterized A. aeolicus proteins contain thermostable structural motifs, consistent with the organism's hyperthermophilic lifestyle. Secondary structure prediction algorithms suggest aq_1793 likely contains a mixture of alpha-helical and beta-sheet regions typical of globular proteins, but experimental validation through circular dichroism or crystallographic studies is required for confirmation.

Why is aq_1793 classified as "uncharacterized" and what implications does this have for research?

The "uncharacterized" designation indicates that aq_1793's biochemical function remains experimentally undetermined, despite its conservation in the A. aeolicus genome. This classification stems from limitations in sequence-based functional annotation, particularly for proteins from phylogenetically distant organisms like A. aeolicus, which diverged early in bacterial evolution. For researchers, this presents both challenges and opportunities: while functional prediction requires more extensive experimental validation, discovering the function of aq_1793 could reveal novel biochemical pathways or adaptations specific to hyperthermophiles. Research approaches should therefore combine computational prediction with diverse biochemical assays rather than relying on sequence homology alone.

What expression systems are most effective for recombinant aq_1793 production?

For thermostable proteins like aq_1793, the T7 promoter-based expression system in E. coli represents an effective starting approach . Based on successful expression of other A. aeolicus proteins, the following methodology is recommended:

  • Clone the aq_1793 gene into a vector containing the T7 promoter, such as pET21b or pGRASS

  • Transform into an E. coli expression strain containing T7 RNA polymerase (e.g., BL21(DE3))

  • Induce expression with IPTG at concentrations between 0.1-1.0 mM

  • Optimize growth temperature (typically 18-30°C) and duration (4-24 hours) to maximize soluble protein yield

The pGRASS vector system offers particular advantages for aq_1793 cloning, as it incorporates a GFP-based screening system for positive selection of recombinant clones with correct orientation . This system uses a selection cassette with a weak promoter driving GFP expression in the opposite orientation to the target gene expression cassette, enabling visual screening of successful transformants.

How can solubility challenges with aq_1793 be addressed during expression?

As a protein from a hyperthermophile, aq_1793 may face folding challenges in mesophilic expression hosts. To optimize solubility:

  • Co-express with molecular chaperones (GroEL/GroES or DnaK/DnaJ/GrpE systems)

  • Utilize fusion tags known to enhance solubility (e.g., MBP, SUMO, or thioredoxin)

  • Add low concentrations (0.5-2%) of mild solubilizing agents like glycerol or sorbitol to the growth medium

  • Employ a heat-shock step (60-80°C) during purification to precipitate E. coli proteins while retaining thermostable aq_1793

Additionally, expression in specialized E. coli strains like Rosetta (addressing rare codon usage) or Origami (enhancing disulfide bond formation) may improve yields of properly folded protein.

What purification strategy is recommended for recombinant aq_1793?

A multi-step purification protocol is recommended for obtaining high-purity aq_1793:

  • Initial heat treatment (75°C for 20 minutes) to exploit the thermostability of aq_1793

  • Immobilized metal affinity chromatography (IMAC) using the hexa-histidine tag incorporated through the pGRASS vector

  • Size exclusion chromatography for final polishing and buffer exchange

Purification StepConditionsExpected OutcomeQuality Control
Heat treatment75°C, 20 min40-60% enrichmentSDS-PAGE
IMAC20 mM imidazole wash, 250 mM imidazole elution>80% puritySDS-PAGE
Size exclusionSuperdex 75/200, 50 mM Tris pH 8.0, 150 mM NaCl>95% puritySDS-PAGE, Dynamic Light Scattering

This protocol typically yields 2-10 mg of purified protein per liter of bacterial culture, suitable for subsequent structural and functional analyses.

What crystallization strategies are appropriate for structural determination of aq_1793?

For crystallization of hyperthermophilic proteins like aq_1793, the following methodological approach is recommended:

  • Prepare highly purified protein (>95% by SDS-PAGE) at concentrations between 10-20 mg/mL

  • Screen temperature conditions (4°C, room temperature, and 37°C) as thermal stability may affect crystallization kinetics

  • Utilize sparse matrix screening followed by optimization of promising conditions

  • Consider additive screening with small molecules that may stabilize specific conformations

Based on crystallization success with other A. aeolicus proteins, initial screening should include conditions containing sulfate ions, which have facilitated crystal formation in related proteins . The crystallization process may benefit from higher temperatures (30-37°C) that better match the protein's native environment, potentially stabilizing its natural conformation.

How can computational methods complement experimental studies of aq_1793?

Computational approaches provide valuable insights into aq_1793 structure and function:

  • Homology modeling using related structures from thermophilic organisms

  • Molecular dynamics simulations at elevated temperatures (80-100°C) to study thermostability mechanisms

  • Codon usage analysis to identify potentially functionally important regions

Analysis of codon usage in aq_1793 can be performed using computational tools similar to those described in the literature , which may reveal evolutionary signatures or expression-level adaptations. Stem-loop structures in the 5' leader sequence can be analyzed using tools like CentroidFold to identify potential regulatory elements affecting expression .

What spectroscopic methods provide insights into aq_1793 structure?

Multiple spectroscopic techniques offer complementary structural information:

  • Circular Dichroism (CD) spectroscopy - For secondary structure estimation (α-helix vs. β-sheet content)

  • Fluorescence spectroscopy - To assess tertiary structure through intrinsic tryptophan fluorescence

  • Differential Scanning Calorimetry (DSC) - To determine thermal stability and unfolding transitions

For thermostable proteins like aq_1793, measuring CD spectra at elevated temperatures (up to 95°C) can reveal structural transitions and thermostability characteristics. These data can be particularly valuable when crystallization proves challenging or as complementary information to crystallographic studies.

What approaches can determine the biochemical function of uncharacterized proteins like aq_1793?

A systematic, multi-faceted approach is recommended for functional characterization:

  • Genomic context analysis - Examining neighboring genes for functional clues

  • Structure-based function prediction - Using structural similarity to proteins of known function

  • Activity screening - Testing for common enzymatic activities (hydrolase, transferase, etc.)

  • Protein-protein interaction studies - Identifying potential binding partners

Given the genomic proximity of aq_1793 to the ntrC2 gene (encoding a transcriptional regulator) , investigating potential roles in transcriptional regulation or nitrogen metabolism pathways would be a logical starting point. The gene's low GC content (36.42%) relative to the genome average suggests possible horizontal gene transfer, which might indicate specialized or adaptive functions .

How can protein-protein interaction studies inform aq_1793 function?

To identify potential interaction partners:

  • Bacterial two-hybrid screening using A. aeolicus genomic libraries

  • Pull-down assays using tagged recombinant aq_1793 as bait

  • Cross-linking coupled with mass spectrometry to capture transient interactions

  • Co-immunoprecipitation studies if antibodies against aq_1793 are available

When designing these experiments, consider the thermophilic nature of A. aeolicus and potential temperature-dependent interactions. Partner proteins may include other hypothetical proteins in the same genomic region, such as aq_1794 or aq_1797, which are also uncharacterized .

What enzymatic activity assays should be prioritized for aq_1793?

Without clear sequence-based functional predictions, a broad screening approach is recommended:

Activity ClassAssay MethodControlsDetection
Hydrolasep-nitrophenyl ester substratesPositive: known esteraseSpectrophotometric (405 nm)
TransferaseRadiolabeled donor substratesPositive: related transferaseScintillation counting
OxidoreductaseNAD(P)H consumptionPositive: dehydrogenaseFluorescence (340/460 nm)
DNA/RNA bindingElectrophoretic mobility shiftPositive: known DNA-binding proteinGel visualization

Given its genomic context near regulatory proteins (ntrC2), testing for DNA-binding activity or protein phosphorylation/dephosphorylation would be particularly relevant. Additionally, the thermophilic nature of A. aeolicus suggests assays should be conducted at elevated temperatures (70-95°C) when possible.

How does the extreme thermophile origin affect research approaches for aq_1793?

The hyperthermophilic origin of aq_1793 necessitates specialized research considerations:

  • Temperature optimization - All activity assays should include temperature gradients (60-95°C)

  • Buffer stability - Use thermostable buffers like CHES or CAPS for high-temperature experiments

  • Equipment adaptation - Modify equipment for high-temperature compatibility

  • Comparative analysis - Include mesophilic homologs (if identified) as controls

The thermostability of A. aeolicus proteins often correlates with unique structural features, including increased ionic interactions, disulfide bonds, and hydrophobic core packing. Characterizing these features in aq_1793 could provide insights into both its specific function and general principles of protein thermostability.

How can contradictory experimental results for aq_1793 be resolved?

When facing conflicting experimental outcomes:

  • Evaluate protein quality - Verify proper folding through thermal shift assays and CD spectroscopy

  • Test concentration-dependence - Activity may appear only at specific protein concentrations

  • Examine cofactor requirements - Test activity with various metal ions or small molecule cofactors

  • Consider physiological context - Replicate conditions similar to A. aeolicus cellular environment

Importantly, validation through multiple independent methods is essential for uncharacterized proteins like aq_1793. For instance, an observed enzymatic activity should be confirmed through both activity assays and structural analysis of enzyme-substrate complexes.

What evolutionary insights can advance understanding of aq_1793 function?

Evolutionary analysis provides powerful context for functional hypotheses:

  • Phylogenetic profiling - Identifying organisms containing aq_1793 homologs

  • Synteny analysis - Comparing gene neighborhood conservation across species

  • Evolutionary rate analysis - Identifying rapidly or slowly evolving regions

  • Ancestral sequence reconstruction - Inferring functional constraints through evolutionary history

A. aeolicus represents one of the earliest-branching bacterial lineages, making evolutionary analysis of its proteins particularly valuable for understanding ancient protein functions. Comparing aq_1793 to homologs in other thermophiles versus mesophiles can highlight adaptations specific to high-temperature environments versus conserved functional regions.

How should experiments be designed to test multiple hypotheses about aq_1793 function?

A systematic experimental design approach includes:

  • Generate multiple functional hypotheses based on:

    • Genomic context near ntrC2 (transcriptional regulator)

    • Structural predictions and fold recognition

    • Evolutionary relationships

  • Design parallel validation experiments:

    • Target gene knockouts or complementation studies

    • Site-directed mutagenesis of predicted functional residues

    • Heterologous expression to test phenotypic effects

  • Implement multidimensional analysis:

    • Combine structural studies with functional assays

    • Correlate in vitro biochemical data with in vivo phenotypes

    • Apply quantitative and qualitative methods in parallel

This approach allows efficient elimination of incorrect hypotheses while building evidence for the true function through convergent results from multiple experimental strategies.

What methodological challenges are specific to recombinant aq_1793 research?

Key methodological challenges include:

  • Expression system limitations - E. coli may not properly fold thermophilic proteins

  • Post-translational modification differences - Any native modifications may be absent

  • Functional context loss - Cellular partners or cofactors may be missing in vitro

  • Temperature optima mismatch - Standard assay conditions may not reveal temperature-dependent activities

To address these challenges, consider using the OLIVAR methodology and pGRASS vector system , which provides improved selection of recombinant clones through GFP reporter expression. This system integrates selection and expression cassettes in opposite orientations, allowing visual identification of recombinants through fluorescence screening .

How can research data on aq_1793 be effectively managed and shared?

Best practices for research data management include:

  • Standardized documentation:

    • Record all experimental parameters (temperature, pH, buffer composition)

    • Document protein batch characteristics (purity, concentration, activity)

    • Maintain detailed protocols with version control

  • Data repository utilization:

    • Deposit structures in the Protein Data Bank (similar to existing A. aeolicus structures)

    • Share genomic data through NCBI databases

    • Utilize specialized repositories for specific data types (e.g., proteomics, interaction data)

  • Collaborative platforms:

    • Establish shared electronic lab notebooks

    • Implement consistent metadata schemes

    • Create accessible data visualization tools

Following these practices ensures reproducibility and maximizes the value of research efforts on this challenging uncharacterized protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.