Recombinant Aquifex aeolicus Uncharacterized protein aq_1849 (aq_1849)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aq_1849; Uncharacterized protein aq_1849
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-219
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
aq_1849
Target Protein Sequence
MKAYLFIFIFLFLLNFLILFFVLKTELIVSSLIAGGYALFVSAFTSYVYTKKVEKLLGVL LYFAEFVYENRQNLEGSVFYSPLYEELRDIVSYIEGGIKNVKSSLEKQLADVHVEYTEVV EKLGQIMEVVERLKQGEIEYGALPTGLDPAGALGEILRESLSEIAKKIDNIKRKIYELDD TIKKVKNYAEAGEEELVKAEITRTKSILEEIEKELEFFK
Uniprot No.

Target Background

Database Links

KEGG: aae:aq_1849

STRING: 224324.aq_1849

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the optimal expression system for recombinant Aquifex aeolicus protein aq_1849?

  • Vector selection: Use pET expression vectors with a His-tag for simplified purification. The N-terminal tag position appears favorable based on available recombinant preparations .

  • Host strain selection: BL21(DE3) or Rosetta(DE3) strains are recommended, with the latter preferred if rare codon usage is detected in the aq_1849 sequence.

  • Expression conditions:

    • Initial induction: 0.5-1.0 mM IPTG

    • Temperature: 16-18°C for 18-24 hours (lower temperatures often improve folding for thermophilic proteins)

    • Media: TB (Terrific Broth) supplemented with appropriate antibiotics

  • Expected yield: Typically 10-15 mg/L of culture for hyperthermophilic proteins expressed in E. coli systems.

Note that while the protein's natural host is hyperthermophilic, expression in mesophilic systems like E. coli remains the standard approach due to practical limitations, though special considerations for thermostable protein folding must be addressed.

What are the recommended storage conditions for maintaining aq_1849 protein stability?

For optimal stability of the recombinant aq_1849 protein, adhere to the following storage protocol based on experimental data:

  • Short-term storage (up to one week):

    • Store working aliquots at 4°C in Tris-based buffer

    • Avoid repeated freeze-thaw cycles as they can significantly reduce protein activity

  • Long-term storage:

    • Store at -20°C or preferably -80°C for extended stability

    • Use buffer containing 50% glycerol for -20°C storage

    • For lyophilized preparations, maintain at -20°C/-80°C in the presence of 6% trehalose

  • Reconstitution protocol:

    • Centrifuge vial briefly before opening to collect contents at the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 50% for samples intended for -20°C storage

The high thermostability of A. aeolicus proteins generally confers greater storage stability compared to mesophilic proteins, but proper buffer conditions are still critical for maintaining structural integrity and biological activity.

How should I design experimental controls when working with an uncharacterized protein like aq_1849?

Designing appropriate controls for experiments involving the uncharacterized protein aq_1849 requires a systematic approach:

  • Negative controls:

    • Buffer-only control to establish baseline readings

    • Heat-denatured protein (particularly relevant for thermostable proteins)

    • Expression host (E. coli) lysate containing empty vector

  • Positive controls:

    • Structurally similar characterized protein from A. aeolicus if available

    • Known protein with predicted similar function based on bioinformatic analysis

    • Commercial standard protein with similar molecular weight (219 aa)

  • Time-dependent controls:

    • Fresh vs. stored protein samples to assess stability effects

    • Multiple time points for kinetic assays

  • Specificity controls:

    • Mutant versions of aq_1849 with altered predicted functional sites

    • Competitive inhibition experiments

    • Cross-reactivity tests with related proteins

  • Technical replicates:

    • Minimum of three independent experimental replicates

    • Different protein preparation batches to account for batch-to-batch variation

For uncharacterized proteins, experimental design should follow a systematic workflow as outlined in experimental research design frameworks , with particular attention to establishing reliable cause-effect relationships.

What approaches are recommended for functional characterization of the uncharacterized protein aq_1849?

Functional characterization of aq_1849 requires a multi-disciplinary approach integrating various experimental methodologies:

  • Bioinformatic prediction:

    • Sequence homology analysis using BLAST and HHpred

    • Structural prediction via AlphaFold2 or RoseTTAFold

    • Conserved domain analysis using InterPro and PFAM

    • Genomic context analysis of aq_1849 locus

  • Structural biology approaches:

    • X-ray crystallography (taking advantage of thermostability)

    • Cryo-electron microscopy

    • NMR spectroscopy for dynamic regions

    • HDX-MS (hydrogen-deuterium exchange mass spectrometry) for conformational studies

  • Interaction studies:

    • Pull-down assays using His-tagged protein

    • Bacterial two-hybrid screening

    • Co-immunoprecipitation with predicted partners

    • Crosslinking mass spectrometry

  • Functional assays based on sequence analysis:

    • The protein's amino acid sequence (MKAYLFIFIFLFLLNFLILFFVLK...) suggests membrane association

    • Design assays for potential membrane transport, signaling, or structural functions

    • Enzymatic activity screening with diverse substrates

  • Expression pattern analysis:

    • qRT-PCR of aq_1849 under various stress conditions

    • Proteomics analysis of A. aeolicus under different growth conditions

    • Localization studies using fluorescent protein fusions

The experimental approach should be iterative, with results from each method informing subsequent experiments in an adaptive research design .

How do I address potential membrane protein characteristics when working with aq_1849?

Addressing the potential membrane protein characteristics of aq_1849 requires specialized approaches:

  • Membrane protein prediction:

    • Analysis of the sequence (MKAYLFIFIFLFLLNFLILFFVLKTELIV...) reveals a hydrophobic N-terminal region characteristic of membrane proteins

    • Use prediction tools (TMHMM, Phobius) to identify transmembrane domains

  • Optimized expression strategies:

    StrategyImplementationAdvantage
    Detergent screeningTest various detergents (DDM, LDAO, etc.)Maintains native structure
    Fusion partnersMBP, SUMO, or mistic tagsEnhances membrane insertion
    Cell-free systemsE. coli extract supplemented with nanodiscs or liposomesAvoids inclusion body formation
    Alternative hostsMembrane-oriented expression hosts like C43(DE3)Better suited for membrane proteins
  • Purification considerations:

    • Inclusion of appropriate detergents in all buffers

    • Gradual detergent exchange during purification

    • Consider amphipol substitution for improved stability

  • Functional assays specific to membrane proteins:

    • Liposome reconstitution to assess transport function

    • Lipid binding assays

    • Membrane insertion assays using fluorescence techniques

  • Structural studies adaptations:

    • Lipidic cubic phase crystallization

    • Cryo-EM in nanodiscs or amphipols

    • Solid-state NMR approaches

Working with membrane proteins from hyperthermophiles adds complexity due to their unique lipid environment in vivo. Consider supplementing experimental buffers with thermostable lipids or using higher temperatures for functional assays to better mimic native conditions.

What approaches can resolve contradictory experimental data when studying aq_1849?

Resolving contradictory experimental data for aq_1849 requires a systematic troubleshooting approach:

  • Source verification:

    • Confirm protein identity via mass spectrometry

    • Validate protein purity (>90% recommended)

    • Sequence verification of expression constructs

  • Methodological reconciliation:

    • Document experimental variables systematically:

      • Temperature conditions (especially critical for thermophilic proteins)

      • Buffer composition and pH

      • Protein concentration and storage history

    • Standardize protocols across research groups

    • Compare in vitro vs. in vivo results and resolution approaches

  • Statistical validation:

    • Increase replicate numbers for conflicting experiments

    • Perform power analysis to ensure adequate sampling

    • Apply appropriate statistical tests based on experimental design

    • Consider meta-analysis approaches for conflicting literature data

  • Alternative methodologies:

    • Deploy orthogonal techniques to address the same question

    • Example: If binding data conflict between ITC and SPR methods, add MST as a third approach

    • Complementary techniques strengthen confidence in results

  • Contextual considerations:

    • Protein conformation may change based on experimental conditions

    • Temperature-dependent structural changes are common in thermophilic proteins

    • Test functionality across a temperature gradient (20-95°C)

When presenting contradictory data, explicitly document all experimental conditions in a comparative table format, followed by a systematic analysis of variables that might explain discrepancies. This approach aligns with proper experimental research design principles that emphasize transparency and reproducibility .

What is the optimal approach for assessing thermostability of the aq_1849 protein?

Assessing thermostability of aq_1849 from the hyperthermophile A. aeolicus requires specialized methodology:

  • Differential Scanning Calorimetry (DSC):

    • Gold standard for determining melting temperature (Tm)

    • Recommended temperature range: 25-120°C

    • Protein concentration: 0.5-1.0 mg/mL in Tris buffer

    • Expected Tm for A. aeolicus proteins: typically 85-105°C

  • Circular Dichroism (CD) spectroscopy:

    • Monitor secondary structure changes at increasing temperatures

    • Take measurements at 5°C intervals from 25-110°C

    • Focus on far-UV spectrum (190-260 nm)

    • Calculate fraction unfolded at each temperature point

  • Thermal shift assays (TSA):

    • Use fluorescent dyes like SYPRO Orange

    • Temperature range: 25-110°C with 0.5°C increments

    • Include controls with well-characterized proteins

    • Sample buffer composition table:

    Buffer ComponentConcentrationRationale
    Tris-HCl pH 8.050 mMMaintains pH at high temperatures
    NaCl150 mMStabilizes electrostatic interactions
    Glycerol5%Prevents aggregation
    SYPRO Orange5XFluorescent indicator
    Protein0.1 mg/mLOptimal for signal detection
  • Activity-based stability assessments:

    • If function is identified, measure activity retention after:

      • Pre-incubation at various temperatures (60-100°C)

      • Prolonged incubation (0-24 hours) at high temperature (90°C)

    • Calculate half-life at different temperatures

  • Dynamic Light Scattering (DLS):

    • Monitor aggregation state at increasing temperatures

    • Collect readings at 5°C intervals from 25-110°C

    • Analyze hydrodynamic radius changes

For all thermostability experiments with aq_1849, include appropriate controls: a mesophilic protein (expected to denature at ~40-60°C) and ideally another A. aeolicus protein with known thermostability profile.

How should I design experiments to study potential protein-protein interactions involving aq_1849?

Designing experiments to study protein-protein interactions (PPIs) for aq_1849 requires consideration of its thermophilic origin and potential membrane association:

  • Pull-down assays:

    • Leverage the His-tag present in recombinant aq_1849

    • Incubate tagged protein with A. aeolicus lysate

    • Wash stringently at elevated temperatures (60-70°C)

    • Identify binding partners via mass spectrometry

    • Control: His-tagged unrelated protein

  • Thermal-adaptation of yeast two-hybrid:

    • Use thermotolerant yeast strains

    • Conduct screens at elevated temperatures (42-45°C)

    • Include membrane-tethered variants to account for potential membrane localization

    • Screen against A. aeolicus genomic library

    • Control: Empty vector and known non-interactor

  • Crosslinking mass spectrometry:

    • Use MS-cleavable crosslinkers (e.g., DSSO)

    • Perform in vivo crosslinking in heterologous host

    • Alternative: reconstituted system with purified components

    • Analyze using specialized crosslinking MS workflows

    • Control: Non-crosslinked samples

  • Surface Plasmon Resonance (SPR):

    • Immobilize His-tagged aq_1849 on NTA sensor chip

    • Test binding with predicted interactors at varied temperatures

    • Experimental design table:

    ParameterRange/SettingRationale
    Temperature25°C, 37°C, 60°CAssess temperature-dependent interactions
    Flow rate30 μL/minOptimal for kinetic analysis
    Analyte concentration0-1000 nMFor KD determination
    Association time180 secAllow equilibrium binding
    Dissociation time600 secComplete dissociation monitoring
  • Biolayer Interferometry (BLI):

    • Alternative to SPR with similar workflow

    • Advantage: requires less protein and handles crude samples better

    • Control: Unrelated protein of similar size

For all PPI experiments with hyperthermophilic proteins like aq_1849, thermal conditions are critical variables. Consider conducting experiments at both standard laboratory temperatures (25-37°C) and elevated temperatures (60-80°C) to capture physiologically relevant interactions that may only occur under conditions mimicking the natural environment of A. aeolicus.

What analytical techniques are most appropriate for structural characterization of aq_1849?

Structural characterization of aq_1849 should leverage multiple complementary techniques, with special considerations for its thermophilic nature and potential membrane association:

For a comprehensive structural characterization of aq_1849, I recommend starting with crystallography and SAXS for initial structural insights, followed by HDX-MS to identify dynamic regions. Use this information to guide further NMR experiments focused on specific regions of interest. For membrane protein characteristics, cryo-EM in nanodiscs may provide the most relevant structural data.

How should I approach sequence analysis of aq_1849 to predict potential functions?

A systematic bioinformatic workflow for predicting potential functions of aq_1849 should incorporate multiple complementary approaches:

  • Primary sequence analysis:

    • Initial assessment of the amino acid sequence (MKAYLFIFIFLFLLNFLILFFVLKTELIV...) reveals high hydrophobicity in the N-terminal region

    • Compute basic physicochemical properties:

      • Molecular weight: ~25 kDa (219 amino acids)

      • Theoretical pI: ~5.5-6.5 (estimate)

      • GRAVY score: Likely positive (hydrophobic)

  • Homology-based function prediction:

    • BLAST search against multiple databases:

      • UniProt (SwissProt + TrEMBL)

      • PDB

      • Specialized extremophile databases

    • Position-Specific Iterative BLAST (PSI-BLAST) for distant homologs

    • Delta-BLAST for domain detection

    • HHpred for remote homology detection

  • Structural prediction and analysis:

    • AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • Structure-based function prediction:

      • ProFunc for structure-based function analysis

      • COFACTOR for enzyme classification

      • COACH for ligand-binding site prediction

    • Protein structure comparison:

      • DALI server for structural neighbors

      • TM-align for topology comparison

  • Domain and motif analysis:

    • InterProScan for integrated domain analysis

    • MOTIF search for functional motifs

    • SignalP for signal peptide prediction

    • TMHMM and TOPCONS for transmembrane domain prediction

    • Data integration table:

    Prediction ToolTarget FeatureExpected Output
    SignalP-6.0Signal peptideCleavage site prediction
    TMHMMTransmembrane helicesNumber and position of TM domains
    InterProScanFunctional domainsDomain architecture
    PSIPREDSecondary structureα-helices, β-sheets distribution
    NetPhosPhosphorylation sitesPotential regulatory sites
  • Genomic context analysis:

    • Examine neighboring genes in A. aeolicus genome

    • Identify conserved operonic structures across related species

    • Search for co-expression patterns in publicly available datasets

The integration of these approaches should yield a comprehensive functional hypothesis that can guide subsequent experimental validation. Given the membrane-associated characteristics suggested by the sequence , I recommend particular attention to transmembrane domain prediction and comparison with known membrane proteins from thermophilic organisms.

What statistical approaches are appropriate for analyzing thermal stability data for aq_1849?

Analyzing thermal stability data for a hyperthermophilic protein like aq_1849 requires specialized statistical approaches:

  • Melting temperature (Tm) determination:

    • Non-linear regression fitting to sigmoidal models:

      • Boltzmann equation: y = A2 + (A1-A2)/(1+exp((x-x0)/dx))

      • 4-parameter logistic model for asymmetric transitions

    • Bootstrap analysis for confidence interval estimation

    • Comparison table of fitting methods:

    Fitting ModelAdvantagesLimitationsBest Application
    BoltzmannSimple, widely usedAssumes symmetrySimple, two-state transitions
    4P LogisticHandles asymmetryMore parametersComplex unfolding profiles
    Derivative methodNo model assumptionsSensitive to noiseNoisy data with clear transition
  • Comparative analysis of stability conditions:

    • Two-way ANOVA for multiple buffer/temperature combinations

    • Post-hoc tests: Tukey's HSD for pairwise comparisons

    • Effect size calculation: η² (eta squared) for practical significance

    • Minimum sample size: n=3 independent experiments, preferably n=5

  • Time-dependent stability analysis:

    • Exponential decay modeling: A(t) = A0·e^(-kt)

    • Half-life calculation: t1/2 = ln(2)/k

    • Arrhenius plot analysis for temperature dependence:

      • ln(k) vs. 1/T plot to calculate activation energy (Ea)

      • Extrapolation for stability at physiological temperature (85-95°C)

  • Statistical handling of thermophilic protein data:

    • Reference state selection: Use 60-70°C as baseline rather than room temperature

    • Temperature normalization: Consider Tm/Topt ratio (melting temperature/optimal growth temperature)

    • Include appropriate thermophilic controls for meaningful comparisons

  • Visualization approaches:

    • Heat maps for stability across multiple conditions

    • 3D surface plots for temperature-pH-stability relationships

    • Arrhenius plots for kinetic stability parameters

    • Forest plots for comparative stability across mutants or homologs

For hyperthermophilic proteins like aq_1849, standard statistical thresholds may need adjustment. Consider that meaningful changes in Tm may be smaller (1-2°C) at high temperatures (>90°C) compared to larger variations (5-10°C) observed in mesophilic proteins. When designing experiments, plan for statistical power sufficient to detect these smaller differences.

How can I reliably interpret functional assay results for an uncharacterized protein like aq_1849?

Interpreting functional assay results for uncharacterized proteins like aq_1849 requires a methodical framework:

  • Establish baseline and variability:

    • Perform multiple independent replicates (minimum n=5)

    • Calculate coefficient of variation (CV) for each assay

    • Establish acceptable CV thresholds before interpreting results:

      • Enzymatic assays: CV < 15%

      • Binding assays: CV < 20%

      • Cell-based assays: CV < 25%

  • Positive and negative controls:

    • Include well-characterized proteins in parallel experiments

    • For thermophilic proteins: include both mesophilic and thermophilic controls

    • Protein-specific negative controls:

      • Heat-denatured aq_1849 (above its thermal stability limit)

      • Site-directed mutants of predicted active sites

      • Buffer-only controls

  • Dose-response relationships:

    • Test across wide concentration ranges (log-scale)

    • Fit appropriate models:

      • Michaelis-Menten for enzymatic activity

      • Hill equation for cooperative binding

      • One-site specific binding for simple interactions

    • Parameter interpretation table:

    ParameterTypical RangeInterpretation for aq_1849
    KmVariableSubstrate affinity - expect higher values at high temperature
    kcatVariableCatalytic rate - compare at both 37°C and 85°C
    KDnM-μMBinding affinity - temperature dependency critical
    Hill coefficient0.5-4.0Cooperativity - indicates multiple binding sites
  • Orthogonal validation:

    • Confirm activity using 2-3 different methodological approaches

    • For enzymatic activity:

      • Spectrophotometric assay

      • HPLC-based substrate depletion

      • Mass spectrometry for product formation

    • For binding interactions:

      • SPR or BLI for kinetics

      • ITC for thermodynamic parameters

      • MST for in-solution confirmation

  • Temperature considerations for thermophilic proteins:

    • Compare activity at multiple temperatures (25°C, 37°C, 60°C, 85°C)

    • Calculate temperature coefficient (Q10) for rate changes

    • Assess thermodynamic vs. kinetic optimization

When interpreting results for aq_1849, consider its natural physiological context in A. aeolicus, which grows optimally at 85-95°C . Activity observed at lower temperatures may not represent physiologically relevant function. For membrane-associated proteins like aq_1849, include appropriate membrane mimetics (detergents, nanodiscs, liposomes) in functional assays to recreate the native environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.