Recombinant Aquifex aeolicus Uncharacterized protein aq_1917 (aq_1917)

Shipped with Ice Packs
In Stock

Description

Definition and Source

Recombinant aq_1917 is a full-length (1–345 amino acid residues) protein expressed in Escherichia coli with an N-terminal His tag for purification . The native protein is encoded by the aq_1917 gene (UniProt ID: O67748) in A. aeolicus, a Gram-negative, chemolithoautotrophic bacterium isolated from hydrothermal environments .

PropertyDetails
Host OrganismAquifex aeolicus (strain VF5)
Recombinant SourceE. coli
TagHis tag
Protein LengthFull-length (345 residues)
Molecular Weight~39.5 kDa (calculated from sequence)
Purity>90% (SDS-PAGE)

Biochemical Properties

The recombinant protein is supplied as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose (pH 8.0) .

ParameterSpecification
Storage Temperature-20°C/-80°C (avoid repeated freeze-thaw cycles)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 50% glycerol for stability
StabilityWorking aliquots stable at 4°C for ≤1 week

Related Studies on A. aeolicus Proteins

Although aq_1917 itself lacks detailed characterization, other proteins from A. aeolicus have been structurally and functionally elucidated:

  • Lumazine synthase (1HQK): A 60-subunit icosahedral enzyme with extreme thermostability (melting temperature: 119.9°C) .

  • NusG (1M1H): A transcription modulator with nucleic acid-binding KOW domains .

  • DUF752: A tRNA-modifying enzyme involved in post-transcriptional uridine methylation .

  • LpxC: A drug target for Gram-negative pathogens, studied in complex with inhibitors like ACHN-975 .

Future Directions

Further research on aq_1917 could focus on:

  • Structural determination: X-ray crystallography or cryo-EM to resolve its 3D architecture.

  • Functional annotation: Screening for enzymatic activity or interaction partners.

  • Biotechnological applications: Leveraging its thermostability for industrial processes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aq_1917; Uncharacterized protein aq_1917
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-345
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
aq_1917
Target Protein Sequence
MEAQAGFDTFIEATRYLFRGPSPQEILLLIIVLGALITVVSLPFFYSKLKEKQRIRENFF RRARDFDLTEEEASVLWKYVKETVLNPNLVFENKAVFEKVVDRIVQNGNPEEIKLISSIR MKLRFSSLPWFIPLTSTRDIEVYQTGVLVVRNRRVDAYVYDKDEEFLYIALLEPVVVKPG ERVSFFFLRENDARYSFDATVEKVFNEGGRTVIVVRHTSEIKRIQLRESVRWKVKLPVKF TLLKENGEEINAEGQLEDISVKGARVCFEGRLDIKEGDRILLDFTLKNYTFKNLLGTVVH QIVYEKRTCLGIKFEELSRKEEEVIGQFILEEQRKLLKAYKEGEV
Uniprot No.

Target Background

Database Links

KEGG: aae:aq_1917

STRING: 224324.aq_1917

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Aquifex aeolicus and why is it significant for protein research?

Aquifex aeolicus represents one of the earliest diverging bacterial lineages and is among the most thermophilic bacteria known, capable of growing at temperatures up to 95°C, which represents the extreme thermal limit for Bacteria. This hyperthermophile functions as a chemolithoautotroph, utilizing hydrogen, oxygen, carbon dioxide, and mineral salts for growth, with its metabolic machinery encoded within a remarkably compact genome of approximately 1,551,335 base pairs—only one-third the size of the Escherichia coli genome .

The significance of A. aeolicus for protein research stems from several factors. First, proteins from hyperthermophilic organisms exhibit exceptional thermal stability, making them valuable models for studying protein folding, stability mechanisms, and enzyme catalysis under extreme conditions. Second, as one of the earliest diverging bacterial lineages, A. aeolicus proteins provide insights into protein evolution and ancient biochemical processes. Third, despite its extreme growth conditions and reduced genome size, A. aeolicus maintains complex metabolic capabilities, suggesting highly efficient and potentially unique protein functions .

What is currently known about protein aq_1917?

Protein aq_1917 from Aquifex aeolicus is currently classified as an uncharacterized protein, indicating limited knowledge about its specific function, structure, and biochemical properties. Available data indicate that aq_1917 is a full-length protein consisting of 345 amino acids . It can be recombinantly expressed in E. coli with a histidine tag, facilitating purification through affinity chromatography techniques .

The genomic context analysis suggests that while aq_1917's function remains undefined, its presence in the highly streamlined genome of A. aeolicus indicates potential significance, as this organism has undergone substantial genome reduction while retaining essential metabolic functions . The retention of aq_1917 in this minimal genome implies it may play an important biological role, though specific pathway associations, biochemical functions, and protein interactions remain to be elucidated.

How can researchers differentiate between basic and advanced approaches when studying uncharacterized proteins?

When investigating uncharacterized proteins like aq_1917, researchers should employ a systematic progression from basic to advanced characterization:

Basic characterization approaches:

  • Sequence analysis and homology searches to identify conserved domains

  • Secondary structure prediction and hydrophobicity analysis

  • Recombinant expression and basic biochemical characterization (solubility, stability, oligomeric state)

  • Preliminary structural analysis through circular dichroism spectroscopy

  • Basic protein-protein interaction screening

Advanced characterization approaches:

  • Three-dimensional structure determination (X-ray crystallography, cryo-EM, NMR)

  • Comprehensive functional assays based on predicted activities

  • Site-directed mutagenesis of predicted catalytic residues

  • In vivo functional complementation studies

  • Systems biology approaches integrating multiple omics datasets

  • Comparative analysis across extremophiles with different growth optima

The methodological distinction involves starting with widely accessible computational and biochemical techniques before progressing to more specialized, resource-intensive experiments that test specific hypotheses about function and structure.

What expression systems are optimal for recombinant production of aq_1917?

Expressing recombinant proteins from hyperthermophiles presents unique challenges due to their distinct codon usage, potential toxicity to host cells, and requirements for proper folding. For aq_1917, the following expression systems should be considered:

Expression SystemAdvantagesLimitationsRecommendations for aq_1917
E. coli BL21(DE3)High yields, simple culture conditions, extensive genetic toolsMay produce inclusion bodies, lacks post-translational modificationsUse with His-tag for IMAC purification; expression at lower temperatures (16-20°C)
E. coli RosettaSupplies rare codons that may be present in A. aeolicus genesHigher metabolic burden on host cellsBeneficial if codon optimization issues are suspected
E. coli ArcticExpressContains cold-adapted chaperones that can assist folding at lower temperaturesSlower growth, potentially lower yieldsUseful if standard BL21 produces insoluble protein
Thermophilic expression hostsNative-like environment for foldingLess developed genetic tools, more complex cultivationConsider for advanced studies of protein folding

For initial characterization, E. coli expression with a His-tag appears most practical, as demonstrated by the successful production of recombinant His-tagged aq_1917 . Co-expression with molecular chaperones may improve solubility if inclusion body formation occurs. When designing expression constructs, researchers should consider both N- and C-terminal His-tags, as tag position can affect protein folding and function.

What purification strategies work best for hyperthermophilic proteins like aq_1917?

Purification of hyperthermophilic proteins benefits from their inherent thermal stability, allowing for unique purification approaches:

  • Heat treatment: After cell lysis, heating the crude extract to 60-70°C can precipitate most mesophilic host proteins while leaving the thermostable aq_1917 in solution. This serves as an effective initial purification step.

  • Immobilized metal affinity chromatography (IMAC): For His-tagged aq_1917, nickel or cobalt affinity resins provide efficient capture . Higher imidazole concentrations in wash buffers can be used due to the protein's stability.

  • Ion exchange chromatography: Based on the predicted isoelectric point of aq_1917, either cation or anion exchange can be employed as a secondary purification step.

  • Size exclusion chromatography: Final polishing and oligomeric state determination can be achieved through gel filtration.

  • Hydrophobic interaction chromatography (HIC): Particularly useful for hyperthermophilic proteins, which often have increased surface hydrophobicity contributing to their thermal stability.

A practical purification protocol would combine: (i) cell lysis, (ii) heat treatment (65°C for 20 minutes), (iii) clarification by centrifugation, (iv) IMAC purification, (v) tag removal if necessary, and (vi) size exclusion chromatography.

What analytical techniques are essential for structural characterization of aq_1917?

A comprehensive structural characterization of aq_1917 should include multiple complementary techniques:

TechniqueInformation ProvidedAdvantages for aq_1917 Analysis
Circular Dichroism (CD)Secondary structure composition, thermal stabilityMonitors unfolding transitions at high temperatures
Dynamic Light Scattering (DLS)Hydrodynamic radius, oligomeric state, aggregation propensityNon-destructive assessment of quality and homogeneity
Differential Scanning Calorimetry (DSC)Thermal denaturation profile, thermodynamic parametersQuantifies the exceptional stability expected for a hyperthermophilic protein
X-ray CrystallographyHigh-resolution 3D structureReveals atomic details of potential active sites and binding pockets
Small-Angle X-ray Scattering (SAXS)Low-resolution solution structure, flexibilityWorks with non-crystallizable samples to provide shape information
Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS)Regional dynamics and solvent accessibilityMaps stable core regions versus flexible domains
Nuclear Magnetic Resonance (NMR)Structure and dynamics in solutionCan identify mobile regions important for function

For an uncharacterized protein like aq_1917, researchers should initially focus on CD and DLS to assess proper folding and homogeneity before proceeding to more resource-intensive techniques like crystallography. The thermostability of aq_1917 may facilitate crystallization efforts, as stable proteins often yield better diffraction-quality crystals.

How can bioinformatic approaches help predict the potential function of aq_1917?

Given the uncharacterized nature of aq_1917, computational approaches offer valuable starting points for functional hypothesis generation:

  • Sequence-based analysis:

    • PSI-BLAST and HHpred for detecting remote homologs

    • Identification of conserved domains using CDD, PFAM, and InterPro

    • Comparison with functionally characterized proteins in specialized databases

  • Structure prediction:

    • AlphaFold2 or RoseTTAFold for high-confidence 3D models

    • Structure-based function prediction using ProFunc or COFACTOR

    • Active site prediction via ConSurf conservation analysis

  • Genomic context analysis:

    • Examination of neighboring genes in the A. aeolicus genome

    • Assessment of gene cluster conservation across related species

    • Prediction of operons that may indicate functional relationships

  • Comparative genomics:

    • Phylogenetic profiling to identify co-evolving proteins

    • Analysis of aq_1917 distribution across thermophilic vs. mesophilic bacteria

    • Identification of horizontal gene transfer events

The integration of these approaches can narrow down potential functions and guide experimental design. For instance, if structure prediction reveals a nucleotide-binding pocket, subsequent biochemical assays can test for nucleotide hydrolysis or binding activities.

What experimental approaches can determine if aq_1917 has enzymatic activity?

To systematically investigate potential enzymatic functions of aq_1917:

  • Substrate screening panels:

    • Test common metabolic intermediates (amino acids, nucleotides, sugars, lipids)

    • Screen cofactor dependencies (metal ions, NAD(P)H, ATP, FAD)

    • Examine activity across temperature ranges (37-95°C)

  • Activity-based protein profiling:

    • Use chemical probes that target specific enzyme classes

    • Apply proteomic approaches to identify modification sites

  • Differential scanning fluorimetry (thermal shift):

    • Screen potential ligands/substrates by measuring changes in thermal stability

    • Identify compounds that bind to and stabilize the protein

  • Metabolomic approaches:

    • Comparative metabolomics between wild-type and aq_1917-expressing cells

    • Identification of metabolites affected by aq_1917 overexpression

  • In vitro translation and enzyme reconstitution:

    • Test incorporation into known biochemical pathways

    • Assemble with potential protein partners identified through interaction studies

Given the hyperthermophilic nature of A. aeolicus, all enzymatic assays should be conducted at elevated temperatures (60-95°C) using appropriate buffers that maintain stability at these temperatures. Particular attention should be paid to the possibility that aq_1917 may be involved in specialized metabolic pathways related to chemolithoautotrophic growth.

How should researchers approach protein-protein interaction studies for aq_1917?

Understanding the protein interaction network of aq_1917 can provide valuable functional insights:

Interaction MethodAdvantagesConsiderations for aq_1917
Pull-down assaysDirectly identifies interacting partnersUse thermostable affinity tags and perform at elevated temperatures
Bacterial two-hybridIn vivo detection of interactionsMay require adaptation for thermophilic conditions
Cross-linking mass spectrometryCaptures transient interactions in native contextCan be performed on A. aeolicus cell extracts
Co-immunoprecipitationExamines interactions under native conditionsRequires specific antibodies against aq_1917
Surface plasmon resonanceQuantifies binding kineticsTests specific hypothesized interactions
Proximity labeling (BioID, APEX)Maps spatial proteome around aq_1917Requires expression of fusion proteins in A. aeolicus

When performing interaction studies with an uncharacterized protein like aq_1917, researchers should consider the native environment. Interactions should be confirmed under conditions that mimic the hyperthermophilic growth environment of A. aeolicus. Pull-down experiments suggest that aq_1917 may co-purify with several proteins, including Aq_880, glutamine synthetase, ribosomal protein S2, PNPase, NusB, and Aq_707 , though these associations require further validation.

How does the extreme thermophilic nature of A. aeolicus influence aq_1917 structure and function?

Proteins from hyperthermophiles like A. aeolicus exhibit distinct adaptations for function at extreme temperatures:

  • Structural adaptations to thermostability:

    • Increased number of salt bridges and electrostatic interactions

    • Higher proportion of hydrophobic amino acids in the protein core

    • Reduction in thermolabile residues (Asn, Gln, Cys, Met)

    • More compact folding with reduced surface loops

  • Functional considerations at high temperatures:

    • Substrate binding must be sufficiently strong to overcome increased thermal motion

    • Catalytic rates may be optimized for high-temperature conditions

    • Cofactor stability becomes a critical factor in enzyme function

    • Protein-protein interactions may require additional stabilizing interfaces

When studying aq_1917, researchers should anticipate these thermophilic adaptations and design experiments accordingly. Activity assays should be performed at elevated temperatures, and stability assessments should include measurements above 90°C to reflect the native growth condition of A. aeolicus . Comparative studies with mesophilic homologs (if identified) can reveal specific thermal adaptation strategies.

What can aq_1917 tell us about protein evolution in early-diverging bacteria?

As a protein from one of the earliest diverging bacterial lineages, aq_1917 offers unique evolutionary insights:

  • Phylogenetic analysis considerations:

    • Position aq_1917 in the context of domain-specific protein families

    • Identify ancestral features versus derived characteristics

    • Assess horizontal gene transfer events through incongruent phylogenies

  • Evolutionary rate analysis:

    • Compare sequence conservation patterns across different bacterial phyla

    • Identify slowly evolving (constrained) regions versus rapid-evolving domains

    • Calculate selection pressures using dN/dS ratios where homologs exist

  • Structural evolution perspectives:

    • Analyze the conservation of structural elements across homologs

    • Identify ancient structural motifs that may predate bacterial diversification

    • Examine co-evolution of interacting protein partners

A. aeolicus has been shown to possess unique molecular machinery, such as a minimal protein-only RNase P system that differs fundamentally from the RNA-based enzymes found in most bacteria . This suggests that aq_1917 may similarly represent an evolutionarily distinct protein with specialized functions adapted to the early-diverging bacterial lineage and extreme thermophilic lifestyle.

How can CRISPR-Cas9 and other genetic tools be adapted for functional studies in A. aeolicus?

Genetic manipulation of extremophiles presents significant challenges, but several approaches can be considered for functional studies of aq_1917:

  • Heterologous expression systems:

    • Expression of aq_1917 in model organisms with established genetic tools

    • Complementation studies in deletion mutants of potential homologs

    • Construction of chimeric proteins with domains from characterized enzymes

  • Adaptation of CRISPR-Cas9 for thermophiles:

    • Engineering thermostable Cas9 variants through directed evolution

    • Optimization of guide RNA stability at high temperatures

    • Development of temperature-resistant selection markers

  • Alternative genetic approaches:

    • Transposon mutagenesis with thermostable transposases

    • Antisense RNA strategies adapted for high-temperature conditions

    • Chemical mutagenesis followed by phenotypic screening

  • Functional reconstitution:

    • In vitro reconstitution of biochemical pathways with purified components

    • Cell-free expression systems derived from thermophilic extracts

    • Liposome encapsulation for mimicking cellular compartmentalization

While direct genetic manipulation of A. aeolicus remains challenging, these approaches can provide valuable functional insights. The development of genetic tools for hyperthermophiles represents an important frontier in extremophile research and would significantly advance our understanding of proteins like aq_1917.

How can structural studies of aq_1917 contribute to protein engineering?

Understanding the structural basis of aq_1917's thermostability can inform broader protein engineering efforts:

  • Thermostability principles extraction:

    • Identification of stabilizing motifs that can be transferred to mesophilic proteins

    • Quantification of contribution from different stabilizing interactions

    • Development of predictive models for engineering thermostable variants

  • Structure-guided engineering applications:

    • Design of chimeric proteins incorporating thermostable domains

    • Rational introduction of stabilizing features into industrial enzymes

    • Development of enzymes functional in mixed organic-aqueous solvents

  • Directed evolution platforms:

    • Use of aq_1917 as a scaffold for evolving new functions

    • Development of high-throughput screening methods at elevated temperatures

    • Exploration of sequence space around thermophilic structural cores

The exceptional stability of proteins from organisms like A. aeolicus makes them valuable starting points for protein engineering. Even without complete functional characterization, the structural features of aq_1917 can provide insights into designing proteins that maintain function under extreme conditions.

What methodological challenges exist in comparative studies of aq_1917 with mesophilic homologs?

Comparative analysis between thermophilic and mesophilic proteins presents several methodological challenges:

ChallengeMethodological Solution
Different optimal conditions for activity assaysDevelop buffer systems that accommodate both proteins at respective optimal temperatures
Structural analysis at different temperature optimaUse temperature-controlled CD, DSC, and NMR to examine structural changes across temperature ranges
Different solubility and stability profilesEmploy adaptive laboratory evolution to generate intermediates with shifted stability profiles
Limited sequence similarity hampering alignmentUtilize structure-based alignments and hidden Markov models to detect remote homology
Different oligomeric statesApply native mass spectrometry and analytical ultracentrifugation across temperature ranges

When designing comparative studies, researchers should establish equivalent functional states rather than equivalent conditions. For example, comparing proteins at their respective temperature optima rather than at the same absolute temperature may provide more meaningful functional insights.

How might future omics approaches advance our understanding of aq_1917?

Emerging technologies in systems biology offer new avenues for understanding uncharacterized proteins like aq_1917:

  • Thermal proteomics profiling:

    • Systematic analysis of the A. aeolicus proteome stability landscape

    • Identification of proteins with similar thermal denaturation profiles

    • Detection of complexes through co-denaturation patterns

  • Single-cell approaches adapted for extremophiles:

    • Development of microfluidic systems resistant to high temperatures

    • Single-cell transcriptomics to identify co-expressed genes

    • Spatial proteomics to determine subcellular localization

  • Integrated multi-omics:

    • Correlation of aq_1917 expression with metabolomic profiles

    • Network analysis to position aq_1917 within cellular pathways

    • Machine learning approaches to predict function from integrated datasets

  • Structural genomics initiatives:

    • High-throughput structural determination of the A. aeolicus proteome

    • Comparative structural analysis across extremophiles

    • Development of specialized fragment screening libraries for hyperthermophilic proteins

These advanced approaches represent the future of research on uncharacterized proteins from extremophiles, potentially revealing functional and evolutionary insights that traditional methods might miss.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.