Recombinant Aquifex aeolicus Uncharacterized protein aq_2036 (aq_2036)

Shipped with Ice Packs
In Stock

Description

The Source Organism: Aquifex aeolicus

Aquifex aeolicus stands as one of the earliest diverging bacterial lineages in evolutionary history and is notable for its extreme thermophilic nature. This organism can thrive at temperatures between 85°C and 95°C, representing the thermal upper limit for bacterial life . As a chemolithoautotroph, A. aeolicus possesses the remarkable ability to synthesize organic compounds using only inorganic carbon sources (carbon dioxide) while deriving energy from inorganic chemical reactions . This metabolic capability is particularly impressive considering its compact genome, measuring only 1,551,335 base pairs—approximately one-third the size of the Escherichia coli genome .

The natural habitat of A. aeolicus encompasses harsh environments such as hot springs, sulfur pools, and thermal ocean vents, where it often serves as a primary carbon fixer in neutral-to-alkaline hot springs above 60°C . Despite its extremely thermophilic nature, genomic analyses have revealed surprisingly few specific indicators of thermophily . The bacterium typically appears as rod-shaped cells measuring between 2-6 μm in length with a diameter of approximately 0.5 μm, often forming aggregates of up to one hundred individual cells .

Full-Length Recombinant Protein

The full-length recombinant version of the aq_2036 protein has been successfully produced using Escherichia coli expression systems . This recombinant product encompasses the complete 216 amino acid sequence of the native protein, additionally fused with an N-terminal histidine tag to facilitate purification and experimental applications . The commercially available protein (product code RFL19374AF) is supplied in lyophilized form with purity exceeding 90% as determined by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) .

Partial Recombinant Protein

A partial version of the recombinant aq_2036 protein is also commercially available (product code CSB-EP527840DNV1), with reported purity exceeding 85% as determined by SDS-PAGE analysis . While the exact region of the protein contained in this partial construct is not specified in the available literature, this variant may offer researchers an alternative option for experiments that do not require the complete protein sequence .

Sequence Analysis

The amino acid sequence of aq_2036 suggests several potential structural features. The presence of multiple hydrophobic segments indicates possible membrane association, which would align with the common observation that many uncharacterized proteins in bacterial genomes are involved in membrane functions . The sequence also contains several lysine-rich regions, which might be involved in protein-protein interactions or nucleic acid binding.

Thermal Stability Considerations

Given its origin from an extreme thermophile, aq_2036 likely possesses intrinsic structural features that contribute to thermostability. Common mechanisms for protein thermostability include increased hydrogen bonding, enhanced hydrophobic interactions, additional salt bridges, and more compact folding patterns. These features would enable the protein to maintain functional conformation at the high temperatures characteristic of A. aeolicus's natural environment .

The following table summarizes the key biochemical properties of recombinant aq_2036:

PropertyDescription
Source OrganismAquifex aeolicus
Expression SystemEscherichia coli
Protein LengthFull Length (1-216 amino acids)
Molecular TagN-terminal Histidine tag
UniProt IDO67827
Purity>90% (SDS-PAGE) for full-length version
Physical FormLyophilized powder

Reconstitution Protocol

For optimal reconstitution, the following procedure is recommended:

  1. Briefly centrifuge the vial prior to opening to ensure the protein powder is collected at the bottom.

  2. Reconstitute in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL.

  3. Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) for long-term storage.

  4. Aliquot the reconstituted protein to minimize future freeze-thaw cycles .

The recommended storage buffer typically consists of a Tris/PBS-based solution containing 6% trehalose at pH 8.0, which helps maintain protein stability .

Fundamental Research Value

The study of uncharacterized proteins like aq_2036 from extremophilic organisms represents a frontier in biochemical research with implications for multiple scientific domains. These investigations contribute to:

  1. Expanding our understanding of protein evolution in extreme environments

  2. Identifying novel enzymatic activities potentially applicable in biotechnology

  3. Elucidating the minimal functional requirements for life in extreme conditions

  4. Enhancing our knowledge of the metabolic pathways and cellular processes in early-diverging bacterial lineages

Potential Biotechnological Applications

Proteins from hyperthermophiles like A. aeolicus frequently demonstrate exceptional stability not only at high temperatures but also in the presence of organic solvents, detergents, and extreme pH conditions. While the specific function of aq_2036 remains uncharacterized, proteins from this organism have significant biotechnological potential, particularly in industrial processes requiring thermostable enzymes . Applications might include biocatalysis, biosensors, or as structural models for protein engineering projects targeting enhanced thermostability.

Future Research Directions

Several promising avenues exist for further characterization of aq_2036:

Functional Determination

A primary research goal would be determining the biological function of aq_2036. Approaches might include:

  • Comparative genomics with newly sequenced extremophiles

  • Gene knockout or silencing studies to observe phenotypic effects

  • Protein-protein interaction studies to identify binding partners

  • Structural analyses using X-ray crystallography or cryo-electron microscopy

Comparative Analysis with Homologous Proteins

Identifying and characterizing potential homologs in other extremophilic and mesophilic organisms could illuminate the evolutionary history and functional conservation of this protein family. Such comparative analyses might reveal functional adaptations specific to thermophilic environments.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
aq_2036; Uncharacterized protein aq_2036
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-216
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
aq_2036
Target Protein Sequence
MRKLISLILVIIFPYISLGLSARIAFSEKFIEWEYSRKNFPEDRWGMEKEERLKLAKLGL KAVISDKGMEEFKKARLKNGKRAFTDREVKHMEDVKRFLSFFFPSVYVLSIIWIAGVFLL RSFDVLIWSGIFNSLLLLFLGILTFTNYEKAFELFHNVVFDPYSWKFRYSDTLIRIYPMK FWYDGTLFVAILSFLFGILVLFTGILGKKFLKGKGA
Uniprot No.

Target Background

Database Links

KEGG: aae:aq_2036

STRING: 224324.aq_2036

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Aquifex aeolicus and why is it significant for protein research?

Aquifex aeolicus is a deep-branching hyperthermophilic chemoautotrophic bacterium found in hydrothermal vents and hot springs. It is significant for protein research for several reasons:

  • It's considered one of the earliest diverging species of thermophilic bacteria in the evolutionary tree

  • It has exceptional thermostability, growing optimally at 85°C and surviving temperatures up to 95°C

  • Despite its high-temperature environment, it has a relatively low G+C content (only 43%), contradicting the intuitive expectation that thermophilic adaptation would favor higher G+C genome content

  • Its proteins have evolved unique structural adaptations to maintain stability and function at extreme temperatures

  • Studies of its proteins can provide insights into early protein evolution and thermostable protein engineering

The organism is rod-shaped (2.0-6.0μm in length and 0.4-0.5μm in diameter), Gram-negative, and motile via monopolar polytrichous flagella. It requires oxygen but grows optimally under microaerophilic conditions .

What are the optimal conditions for recombinant expression and purification of aq_2036?

Based on the available commercial recombinant protein information, the following conditions are recommended:

ParameterRecommended ConditionsNotes
Expression SystemE. coliMost commonly used for recombinant aq_2036
Purification TagHis-tagTypically N-terminal
Buffer CompositionTris-based buffer with glycerolOptimized for protein stability
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLBrief centrifugation prior to opening recommended
Storage-20°C/-80°C with 5-50% glycerol50% glycerol is default in commercial preparations
Working SolutionStore aliquots at 4°CFor up to one week
Stability ConcernsAvoid repeated freeze-thaw cyclesAffects protein integrity

For optimal results when working with proteins from hyperthermophiles like A. aeolicus, consider:

  • Including thermostabilizing agents in buffers (glycerol, certain salts)

  • Using higher temperatures during certain purification steps to take advantage of thermostability

  • Considering detergents for solubilization if the protein has membrane-associated domains

How can researchers determine the cellular localization and topology of aq_2036?

Determining the cellular localization and topology of aq_2036 requires a multi-faceted approach:

  • Computational prediction methods:

    • Transmembrane domain prediction tools (TMHMM, Phobius)

    • Signal peptide prediction (SignalP)

    • Cellular localization prediction (PSORT, DeepLoc)

    • Topology prediction tools (TOPCONS)

  • Experimental approaches:

    • GFP fusion analysis: Creating N- and C-terminal GFP fusions to observe localization patterns

    • Cysteine accessibility method: Introducing cysteine residues at various positions and testing their accessibility to membrane-impermeable reagents

    • Protease protection assay: Determining which regions are protected from proteolytic digestion

    • Immunolocalization: Using antibodies against the protein or epitope tags

    • Membrane fractionation: Separating different membrane components to identify where the protein resides

  • Structural biology approaches:

    • Cryo-electron microscopy of membrane preparations

    • X-ray crystallography of purified protein

    • NMR studies of protein domains

This comprehensive approach would provide valuable insights into the membrane topology and cellular localization of aq_2036, which is essential for understanding its potential function.

What functional assays would be appropriate for characterizing an uncharacterized protein like aq_2036?

When investigating an uncharacterized protein like aq_2036, a systematic approach using multiple functional assays is recommended:

  • Phenotypic analysis of gene deletion/overexpression:

    • Create knockout or overexpression strains in model organisms with homologs

    • Analyze growth under various conditions (temperature, pH, salt, carbon sources)

    • Examine cellular morphology and membrane integrity

  • Protein-protein interaction studies:

    • Yeast two-hybrid screening

    • Pull-down assays with tagged recombinant protein

    • Proximity labeling (BioID, APEX)

    • Co-immunoprecipitation from native organism if antibodies are available

  • Biochemical activity screening:

    • Testing for common enzymatic activities based on structural predictions

    • Membrane transport assays if predicted to be a transporter

    • Ion flux measurements in reconstituted liposomes

    • Lipid binding assays

  • Structural studies to guide functional hypothesis:

    • X-ray crystallography or Cryo-EM to determine structure

    • NMR for dynamic studies and ligand binding

    • Hydrogen-deuterium exchange mass spectrometry for conformational changes

  • In silico approaches:

    • Structural modeling and comparison with functionally characterized proteins

    • Molecular dynamics simulations, especially relevant for hyperthermophilic proteins

    • Binding site prediction and virtual screening for potential ligands

Given that A. aeolicus is a hyperthermophile, assays should be designed to account for potential high-temperature optimum of the protein's activity.

How does the hyperthermophilic nature of A. aeolicus likely influence the structure and stability of aq_2036?

The hyperthermophilic nature of A. aeolicus (growing optimally at 85°C) likely impacts aq_2036's structure and stability in several ways:

  • Increased internal hydrophobicity:

    • More extensive hydrophobic core interactions

    • Reduced cavities within the protein structure

    • Analysis of the aq_2036 sequence shows multiple hydrophobic regions that may contribute to thermostability

  • Enhanced electrostatic interactions:

    • Increased number of ion pairs and networks

    • Optimized surface charge distribution

    • Higher proportion of charged residues in stabilizing positions

  • Conformational rigidity:

    • Decreased loop lengths

    • Higher proportion of secondary structure elements

    • Proline residues in strategic positions to reduce entropy of unfolding

  • Specialized adaptations:

    • Specific amino acid preferences (e.g., increased Glu, Arg content)

    • Reduced thermolabile residues (Asn, Gln, Cys, Met)

    • Strategic disulfide bonds in extracellular domains

  • Membrane protein-specific adaptations:

    • Altered hydrophobic matching with the more fluid membrane at high temperatures

    • Modified lipid-protein interactions

    • Specialized structural features at membrane interfaces

These adaptations would allow aq_2036 to maintain structural integrity and function at temperatures that would denature most mesophilic proteins. Understanding these features could provide valuable insights for protein engineering applications requiring thermostability .

What approaches can be used to identify potential homologs and predict function of aq_2036?

Identifying homologs and predicting function for an uncharacterized protein like aq_2036 requires integrating multiple bioinformatic approaches:

  • Sequence-based homology searches:

    • PSI-BLAST for iterative sequence similarity detection

    • HMMER for profile-based searches against protein family databases

    • Delta-BLAST for domain-enhanced alignments

    • Position-specific scoring matrices to detect remote homologs

  • Structural prediction and comparison:

    • AlphaFold2 or RoseTTAFold for structural modeling

    • DALI, VAST, or TM-align for structural similarity searches

    • ProFunc or COACH for structure-based function prediction

    • Analysis of potential binding pockets and catalytic sites

  • Genomic context analysis:

    • Examination of gene neighborhood in the A. aeolicus genome

    • Identification of conserved gene clusters across species

    • Co-expression patterns with functionally characterized genes

    • Phylogenetic profiling to identify co-evolving genes

  • Domain and motif analysis:

    • InterProScan for functional domain identification

    • MEME for de novo motif discovery

    • Comparison with domain databases (Pfam, SMART, CDD)

    • Analysis of conserved residues within potential functional sites

  • Integrated function prediction:

    • Combined approaches using machine learning algorithms

    • Protein-protein interaction network analysis

    • Metabolic pathway gap identification

    • Structural modeling coupled with molecular docking studies

These approaches may reveal distant relationships to characterized proteins and provide testable hypotheses about the potential function of aq_2036 .

What challenges are associated with expressing and purifying proteins from hyperthermophiles like A. aeolicus in mesophilic host systems?

Expressing proteins from hyperthermophiles in mesophilic hosts like E. coli presents several challenges:

  • Codon usage bias:

    • Differences in codon preference between A. aeolicus and E. coli

    • Potential solution: Codon optimization or use of strains with rare tRNAs

  • Protein folding issues:

    • Incorrect folding at lower temperatures

    • Potential solutions:

      • Heat shock during or after expression

      • Co-expression with chaperones

      • Use of specialized folding-promoting E. coli strains

  • Protein toxicity:

    • Membrane proteins like aq_2036 may disrupt host membranes

    • Potential solutions:

      • Tightly regulated expression systems

      • Expression as inclusion bodies followed by refolding

      • Use of specialized E. coli strains (C41/C43) for membrane proteins

  • Post-translational modifications:

    • Differences in modification patterns

    • Solution: Verify if specific modifications are necessary for function

  • Solubility and stability issues:

    • Tendency to aggregate at lower temperatures

    • Potential solutions:

      • Fusion with solubility-enhancing tags (MBP, SUMO)

      • Expression at higher temperatures

      • Optimization of buffer conditions

  • Purification challenges:

    • Different stability in typical purification buffers

    • Solution: Modified buffers with stabilizing additives

  • Functional verification:

    • Difficulty in confirming proper folding and function

    • Solutions:

      • Thermal shift assays

      • Activity assays at elevated temperatures

      • Circular dichroism to assess secondary structure

Despite these challenges, successful expression of A. aeolicus proteins in E. coli has been reported, including for complex proteins like the ribosome recycling factor , suggesting that proper experimental design can overcome these obstacles.

How can structural biology techniques be applied to study aq_2036?

Structural biology techniques offer powerful approaches to study uncharacterized proteins like aq_2036:

Each technique has complementary strengths, and a multi-method approach would provide the most comprehensive structural characterization of aq_2036.

What can we learn from studying the function of uncharacterized proteins from early-diverging bacterial species like A. aeolicus?

Studying uncharacterized proteins from early-diverging bacterial species like A. aeolicus offers several significant insights:

  • Evolutionary protein development:

    • Reveals ancestral protein functions and structures

    • Provides insights into protein evolution and adaptation mechanisms

    • Helps establish the minimal functional requirements for protein families

  • Fundamental biological processes:

    • Illuminates the core machinery of life that has been conserved through evolution

    • A. aeolicus studies have already provided insights into primitive versions of essential cellular machinery

    • Example: A. aeolicus primase demonstrated unique trinucleotide initiation specificity, revealing evolutionary adaptations in DNA replication machinery

  • Extremophile adaptations:

    • Reveals molecular mechanisms of adaptation to extreme environments

    • Provides insights into protein stability under harsh conditions

    • Identifies novel structural features that confer thermostability

  • Novel biochemical activities:

    • May uncover unique enzymatic activities or regulatory mechanisms

    • Potential source of novel biotechnological applications

    • Could reveal alternative solutions to common biological problems

  • Missing links in metabolic pathways:

    • Helps complete our understanding of core metabolic networks

    • A. aeolicus studies have revealed insights into ancestral metabolic pathways

    • Example: Research has illuminated the evolution of the reductive citric acid cycle in this organism

  • Improved bioinformatic prediction:

    • Enhances sequence-structure-function relationship models

    • Provides data points for improved homology modeling

    • Helps refine algorithms for function prediction from sequence

  • Biotechnological applications:

    • Source of thermostable enzymes for industrial processes

    • Templates for engineered proteins with enhanced stability

    • Potential novel biocatalysts with unique properties

Understanding proteins like aq_2036 contributes to filling critical gaps in our knowledge of early cellular evolution and provides valuable insights into fundamental biological processes.

What techniques are available for studying membrane proteins like aq_2036 in their native lipid environment?

For membrane proteins like aq_2036, maintaining the native lipid environment is crucial for proper structure and function analysis. Several techniques are available:

  • Nanodiscs and lipid nanodiscs:

    • Methodology: Incorporate purified protein into synthetic lipid bilayers stabilized by membrane scaffold proteins

    • Advantages:

      • Defined size and composition

      • Accessibility to both sides of the membrane

      • Compatible with multiple analytical techniques

    • Applications: Functional assays, structural studies, protein-lipid interactions

  • Liposome reconstitution:

    • Methodology: Incorporate protein into lipid vesicles through detergent removal

    • Advantages:

      • Creates compartmentalized system

      • Allows for transport or channel activity measurements

      • Can incorporate fluorescent markers for functional assays

    • Applications: Flux assays, transport studies, lipid requirement analysis

  • Lipid cubic phase (LCP):

    • Methodology: Incorporate membrane proteins into 3D lipidic mesophases

    • Advantages:

      • Mimics native membrane environment

      • Excellent for crystallization of membrane proteins

      • Supports lateral mobility of proteins

    • Applications: X-ray crystallography, functional studies, diffusion measurements

  • Native mass spectrometry:

    • Methodology: Analyze intact membrane protein complexes with bound lipids

    • Advantages:

      • Preserves non-covalent interactions

      • Can identify specific lipid binding

      • Minimal sample requirement

    • Applications: Protein-lipid interactions, oligomeric state determination

  • Styrene maleic acid lipid particles (SMALPs):

    • Methodology: Extract membrane proteins with native lipid environment using SMA copolymer

    • Advantages:

      • Detergent-free extraction

      • Preserves native lipid annulus

      • Compatible with various analytical techniques

    • Applications: Structural studies, native lipid identification, functional assays

  • Electron microscopy of membrane proteins:

    • Methodology: Visualize proteins in lipid environments using cryo-EM

    • Advantages:

      • Near-native conditions

      • Can observe different conformational states

      • Works with heterogeneous samples

    • Applications: Structure determination, conformational analysis, membrane topology

These techniques would be particularly valuable for aq_2036, as its sequence suggests it is likely a membrane protein with multiple transmembrane domains .

How can computational methods help predict the function of uncharacterized proteins like aq_2036?

Computational methods offer powerful approaches for predicting the function of uncharacterized proteins like aq_2036:

  • Homology-based function prediction:

    • Methods: HHpred, HMMER, PSI-BLAST for remote homology detection

    • Approach: Identify distant homologs with known functions

    • Limitations: May miss novel functions not present in characterized homologs

    • Enhancement: Incorporating structural information to detect functional similarities despite low sequence identity

  • Structure-based function prediction:

    • Methods: AlphaFold2/RoseTTAFold for structure prediction, followed by structure comparison

    • Tools: DALI, VAST+, ProFunc, COACH

    • Approach: Generate 3D model and compare with functionally characterized structures

    • Advantage: Can detect functional similarity even with low sequence identity

    • Application: Identifying potential binding pockets or catalytic sites

  • Genomic context analysis:

    • Methods: Gene neighborhood analysis, gene fusion detection, phylogenetic profiling

    • Tools: STRING, GeCont, FunCoup

    • Approach: Analyze genomic location and co-occurrence patterns

    • Rationale: Functionally related genes often cluster together or show similar evolutionary patterns

    • Example: Identifying potential interaction partners or metabolic pathways

  • Protein-protein interaction prediction:

    • Methods: Interolog mapping, domain-based predictions, co-evolution analysis

    • Tools: PRINCE, SMAP, PRISM

    • Application: Predict interaction partners to infer function through association

  • Integrative function prediction:

    • Methods: Machine learning approaches combining multiple evidence types

    • Tools: SIFTER, COFACTOR, ProFunc

    • Approach: Integrate sequence, structure, genomic context, and interaction data

    • Advantage: Higher accuracy through consensus predictions and complementary methods

  • Molecular dynamics simulations:

    • Purpose: Analyze protein dynamics and potential ligand interactions

    • Application for aq_2036: Particularly valuable for understanding thermostability mechanisms

    • Approach: Simulate protein behavior at high temperatures typical of A. aeolicus environment

    • Outcome: Insights into conformational changes and potential functional mechanisms

  • Membrane protein-specific predictions:

    • Tools: MEMSAT, TMHMM, Phobius

    • Application: Predict transmembrane regions and topology

    • Relevance: aq_2036 sequence suggests multiple transmembrane domains

    • Output: Potential transport or signaling functions based on topology

These computational approaches provide testable hypotheses about aq_2036 function that can guide experimental design and prioritize research directions .

What are the current challenges in studying proteins from hyperthermophiles and how can they be addressed?

Studying proteins from hyperthermophiles like A. aeolicus presents several unique challenges:

  • Cultivation difficulties:

    • Challenge: Extreme growth conditions (85-95°C, specific gas mixtures)

    • Solutions:

      • Specialized bioreactors with precise temperature control

      • Development of simplified media formulations

      • Genetic systems for model hyperthermophiles as alternative expression hosts

  • Limited genetic tools:

    • Challenge: Few transformation systems and selectable markers for hyperthermophiles

    • Solutions:

      • Development of CRISPR-Cas systems adapted for high temperatures

      • Thermostable selectable markers

      • Shuttle vectors between mesophilic and thermophilic organisms

  • Protein expression issues:

    • Challenge: Expression in E. coli often leads to misfolding or inactivity

    • Solutions:

      • Customized expression systems (temperature shifts, specialized strains)

      • Co-expression with thermophilic chaperones

      • Cell-free expression systems with components from thermophiles

  • Assay complications:

    • Challenge: Standard biochemical assays may not work at high temperatures

    • Solutions:

      • Thermostable reagents and buffers

      • Modified assay platforms for high-temperature compatibility

      • Adaptation of analytical instruments for elevated temperatures

  • Structural biology limitations:

    • Challenge: Membrane proteins like aq_2036 are difficult to crystallize

    • Solutions:

      • Lipidic cubic phase crystallization

      • Cryo-EM in nanodiscs or amphipols

      • NMR at elevated temperatures

  • Understanding native environment:

    • Challenge: Replicating the in vivo conditions of hyperthermophiles

    • Solutions:

      • High-pressure, high-temperature bioreactors

      • In situ studies at hydrothermal vents

      • Environmental genomics and transcriptomics

  • Functional annotation challenges:

    • Challenge: Many proteins remain uncharacterized due to unique adaptations

    • Solutions:

      • Improved computational methods incorporating thermophile-specific features

      • Targeted functional genomics approaches

      • Comparative studies across temperature gradients

  • Membrane composition differences:

    • Challenge: A. aeolicus has unique membrane lipids for thermostability

    • Solutions:

      • Extraction and use of native lipids for reconstitution

      • Synthetic lipid mixtures mimicking thermophile membranes

      • Analysis of protein-lipid interactions at high temperatures

A combination of these approaches would help address the current challenges in studying aq_2036 and other proteins from hyperthermophiles .

What role might aq_2036 play in the adaptation of A. aeolicus to its extreme environment?

Based on sequence analysis and what we know about A. aeolicus, aq_2036 may play several potential roles in environmental adaptation:

  • Membrane integrity maintenance:

    • The multiple predicted transmembrane domains suggest aq_2036 could help maintain membrane stability at extreme temperatures

    • The protein might interact with unique membrane lipids found in hyperthermophiles

    • It may contribute to the proton impermeability necessary at high temperatures

  • Ion or metabolite transport:

    • The protein's structure suggests potential transport function

    • It may facilitate specific nutrient uptake required for A. aeolicus' chemolithoautotrophic lifestyle

    • Could be involved in metal ion homeostasis, crucial for surviving in hydrothermal vent environments

  • Stress response system:

    • May function in sensing or responding to environmental stressors

    • Could be involved in temperature sensing or response

    • Might participate in oxidative stress defense, important in A. aeolicus' microaerophilic lifestyle

  • Cell signaling:

    • May transduce environmental signals across the membrane

    • Could coordinate cellular responses to changing conditions

    • Potentially involved in chemotaxis or other sensing mechanisms

  • Specialized metabolism:

    • Might participate in A. aeolicus' hydrogen oxidation pathways

    • Could be involved in carbon fixation via the reductive citric acid cycle

    • May play a role in energy conservation under extreme conditions

  • DNA protection or repair:

    • A. aeolicus has mechanisms to protect DNA at high temperatures

    • aq_2036 could potentially contribute to nucleic acid stability systems

    • May be involved in specialized DNA repair mechanisms needed at high temperatures

  • Protein quality control:

    • Could function in refolding or degradation of misfolded proteins

    • May assist in protein stability at extreme temperatures

    • Potentially involved in protein turnover regulation

Analysis of the genomic context of aq_2036 and comparative studies with other extremophiles would provide further insights into its potential role in environmental adaptation. Experimental studies comparing wild-type A. aeolicus with aq_2036 mutants under various stress conditions would be particularly informative .

What methodological approaches would be most effective for determining the physiological role of aq_2036 in A. aeolicus?

Determining the physiological role of aq_2036 requires a comprehensive approach combining multiple methodologies:

  • Genetic manipulation strategies:

    • Gene deletion or silencing: Create knockout mutants to observe phenotypic changes

    • Overexpression studies: Analyze effects of increased protein levels

    • Complementation analysis: Test functional conservation in related organisms

    • Challenge: Limited genetic tools for A. aeolicus require development of transformation protocols

    • Alternative: Heterologous expression of aq_2036 in model thermophiles with genetic systems

  • Phenotypic characterization:

    • Growth assays: Compare wild-type and mutant growth under various conditions

    • Stress response tests: Analyze survival under different temperatures, pH, and oxidative stress

    • Metabolic profiling: Identify changes in metabolite profiles between wild-type and mutants

    • Microscopy: Examine cell morphology and membrane integrity changes

  • Localization studies:

    • Fluorescent protein fusions: Observe cellular localization (if compatible with high temperature)

    • Immunolocalization: Use antibodies against aq_2036 or epitope tags

    • Membrane fractionation: Determine precise membrane localization

    • Protease accessibility: Map membrane topology

  • Interaction partner identification:

    • Co-immunoprecipitation: Identify protein complexes containing aq_2036

    • Crosslinking studies: Capture transient interactions

    • Proximity labeling: Identify neighboring proteins in native environment

    • Bacterial two-hybrid: Screen for interaction partners in a heterologous system

  • Functional assays based on predictions:

    • Transport assays: If predicted to be a transporter

    • Signaling assays: If predicted to be involved in signal transduction

    • Enzymatic activity tests: Based on structural predictions

    • Thermal stability assays: Compare membrane stability in presence/absence of aq_2036

  • Environmental response studies:

    • Transcriptional regulation analysis: Determine conditions affecting aq_2036 expression

    • Proteomics: Identify changes in protein abundance under different conditions

    • In situ studies: Analyze expression in natural hydrothermal vent environments if possible

  • Structural studies correlated with function:

    • Structure determination: Using X-ray crystallography or cryo-EM

    • Mutational analysis: Test predictions from structure

    • Ligand binding studies: Identify potential substrates or binding partners

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.