Recombinant Aquifex aeolicus Uncharacterized protein aq_2145 (aq_2145)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aq_2145; Uncharacterized protein aq_2145
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-216
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
aq_2145
Target Protein Sequence
MANKRKEFIKLNLNKERKAFIELRGINLELLKEFLSSNVLPLTFIGSLLILILTIVYYFT LSGSVNELKNEISKEKSKKERLLSEIKRLEELKKTLETKKAIYEVVKIYNDMVIKILENP VNLPYGYSLQNFSLCAFRFKNCDIQEKLNKDKSFSLDKPIAQLDLVLFNRKLENYIPPDS IRKFTYVVIDNLPYRRVCIEPDYERLLAEKGHRKEE
Uniprot No.

Target Background

Database Links

KEGG: aae:aq_2145

STRING: 224324.aq_2145

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the biological significance of Aquifex aeolicus in evolutionary research?

Aquifex aeolicus serves as the model organism for the deeply rooted phylum Aquificae and plays a crucial role in our understanding of early life and evolution. This hyperthermophilic bacterium thrives in extremely hot marine habitats, particularly those rich in sulphur compounds commonly found in volcanic environments. As an H2-oxidizing microaerophile, it possesses unique metabolic adaptations that make it valuable for studying primordial biochemical mechanisms. The organism's position in phylogenetic trees suggests it may represent one of the earliest bacterial lineages, providing insights into the biochemical processes that might have existed in early life forms on Earth. Its study has significantly contributed to our understanding of the origins of life and evolutionary trajectories of core metabolic pathways .

How do the extreme thermophilic properties of Aquifex aeolicus affect research methodologies?

The hyperthermophilic nature of Aquifex aeolicus, which grows optimally at temperatures around 85-95°C, necessitates specialized research approaches. Proteins from this organism, including aq_2145, possess remarkable thermal stability that requires adaptation of standard biochemical techniques.

Methodology considerations include:

Research PhaseStandard ApproachModified Approach for A. aeolicus
Protein Expression37°C E. coli cultureLower expression temperatures to improve folding
PurificationRoom temperature buffersThermostable buffers resistant to precipitation
Activity Assays25-37°C incubationElevated temperature assays (60-95°C)
Storage-20°C/-80°CGreater stability at room temperature possible
Structural StudiesStandard crystallizationModified conditions accounting for thermostability

Researchers must account for the hyper-stable nature of A. aeolicus proteins, which often retain activity and structure at temperatures that would denature proteins from mesophilic organisms. This thermal stability can be advantageous for certain applications but requires careful experimental design to ensure relevant physiological conditions are maintained .

What expression systems are optimal for recombinant aq_2145 production?

The optimal expression system for recombinant aq_2145 production requires careful consideration of several factors. While E. coli remains the most commonly used host for expressing A. aeolicus proteins, including aq_2145, several modifications to standard protocols enhance success rates:

E. coli expression optimization strategies:

  • Use of specialized strains (e.g., Rosetta, Arctic Express) designed for proteins with challenging expression profiles

  • Codon optimization of the aq_2145 sequence for E. coli expression

  • Lower induction temperatures (15-25°C) to enhance proper folding

  • Extended expression times (16-24 hours) at reduced temperatures

  • Addition of compatible solutes or osmolytes to stabilize protein folding

Current evidence indicates successful expression of His-tagged aq_2145 in E. coli systems, resulting in protein that can be purified and maintained as a lyophilized powder. This suggests that despite the thermophilic origin, E. coli can correctly express this protein when appropriate conditions are employed .

When designing experiments involving recombinant aq_2145, researchers should include controls that verify proper folding and stability, particularly when expressed in mesophilic hosts like E. coli. This typically involves thermal stability assays and structural verification through circular dichroism or limited proteolysis.

What purification strategies yield the highest purity and activity for aq_2145?

Purification of recombinant aq_2145 requires a multi-step approach to achieve high purity while maintaining native structure and potential activity. Based on available information about this protein and similar proteins from Aquifex aeolicus, the following purification strategy is recommended:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged aq_2145

  • Heat Treatment: Incubation at 70-80°C for 15-20 minutes to precipitate E. coli host proteins while retaining thermostable aq_2145

  • Secondary Purification: Size exclusion chromatography to remove aggregates and further increase purity

  • Optional Polishing: Ion exchange chromatography if higher purity is required

Purification buffers should:

  • Maintain pH between 7.5-8.0 (typically Tris-based)

  • Include 150-300 mM NaCl to maintain solubility

  • Contain low concentrations of imidazole (5-10 mM) in washing buffers

  • Use 250-300 mM imidazole for elution from IMAC

  • Potentially include reducing agents if cysteine residues are present

Current data indicates that purified aq_2145 protein can achieve greater than 90% purity as determined by SDS-PAGE, making it suitable for most research applications . For specialized structural or functional studies, additional purification steps may be necessary.

How should storage and reconstitution protocols be optimized for aq_2145?

The storage and reconstitution of aq_2145 requires careful attention to maintain protein integrity and functionality. The recommended protocols are:

Storage:

  • Short-term (1 week): Store at 4°C in Tris/PBS-based buffer at pH 8.0

  • Long-term: Store at -20°C/-80°C with cryoprotectants

  • Lyophilized state: Most stable form for extended storage

  • Avoid repeated freeze-thaw cycles which can lead to protein degradation

Reconstitution of lyophilized aq_2145:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as default)

  • Aliquot for long-term storage at -20°C/-80°C

The addition of trehalose (6%) to storage buffers has been shown to enhance stability of aq_2145, likely by preventing protein aggregation during freeze-thaw cycles . Due to the thermostable nature of A. aeolicus proteins, aq_2145 may demonstrate greater resistance to denaturation during storage than typical proteins, but optimal conditions should still be maintained to preserve structural integrity.

What approaches are most effective for determining the structure of uncharacterized proteins like aq_2145?

For uncharacterized proteins like aq_2145, a multi-technique approach to structural determination offers the most comprehensive insights:

X-ray Crystallography:

  • Primary method for high-resolution structure determination

  • Requires optimization of crystallization conditions specific to thermostable proteins

  • May benefit from screening at elevated temperatures (30-45°C)

  • Often requires extensive screening due to unpredictable crystallization behavior

NMR Spectroscopy:

  • Valuable for proteins under 25-30 kDa (potential for aq_2145 at 216 aa)

  • Provides information about dynamics and potential interaction sites

  • May require 15N/13C labeling during expression

  • Heat-stable properties may allow for extended data collection periods

Cryo-Electron Microscopy:

  • Increasingly valuable for membrane proteins or large complexes

  • No crystallization required

  • May be combined with single-particle analysis

  • Requires purified protein in a native-like state

Computational Structure Prediction:

  • Tools like AlphaFold2 have revolutionized structure prediction

  • Particularly valuable for uncharacterized proteins like aq_2145

  • Should be validated with experimental data when possible

  • Can guide hypothesis formation about function

Since many proteins from Aquifex aeolicus have been structurally characterized, comparative analysis with solved structures may provide additional insights, even before experimental determination of aq_2145's structure is complete .

What experimental designs best elucidate the biological function of uncharacterized proteins like aq_2145?

Determining the biological function of uncharacterized proteins like aq_2145 requires a systematic, multi-faceted experimental approach:

  • Sequence-Based Analysis:

    • Homology searching against characterized proteins

    • Domain identification and conserved motif analysis

    • Evolutionary conservation patterns across species

    • Genomic context analysis (neighboring genes often have related functions)

  • Expression Pattern Analysis:

    • Transcriptomic profiling under various conditions

    • Proteomics to determine abundance and co-expression partners

    • Localization studies using fluorescent tags or fractionation

  • Interaction Studies:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Yeast two-hybrid or bacterial two-hybrid screens

    • Protein microarrays to identify binding partners

    • Co-immunoprecipitation with suspected interaction partners

  • Phenotypic Studies:

    • Gene knockout or knockdown analysis

    • Overexpression studies to observe gain-of-function effects

    • Complementation assays in model organisms

  • Biochemical Characterization:

    • Activity assays for common enzymatic functions

    • Substrate screening with metabolite libraries

    • Structural studies to identify potential active sites

For thermophilic proteins like aq_2145, these approaches must be adapted to account for optimal temperature conditions and potential unique biochemical properties associated with extremophiles .

How can researchers effectively compare experimental data across different studies of aq_2145?

Effective comparison of experimental data across different studies requires standardized approaches to minimize variability and ensure reproducibility:

Data TypeStandardization MethodsKey Considerations for aq_2145
Structural DataReference to standard PDB formatsTemperature of structure determination
Activity AssaysStandard units (e.g., μmol/min/mg)Temperature and pH of assay conditions
Expression Yieldsmg/L of cultureExpression system and conditions used
Stability MeasurementsTm values, half-life measurementsBuffer composition and measurement methods
Binding StudiesKd, Ka valuesEquilibration time at elevated temperatures

Meta-analysis approaches should:

  • Systematically document experimental conditions across studies

  • Normalize data to account for methodological differences

  • Apply statistical analyses appropriate for small sample sizes

  • Consider the impact of different tags (His-tag positioning) on protein behavior

  • Document sequence variations if different constructs are used

For aq_2145 specifically, researchers should establish a community standard for the expression construct and basic characterization methods to facilitate cross-study comparisons. This is particularly important for uncharacterized proteins where cumulative knowledge building is essential for functional determination .

How might the study of aq_2145 contribute to understanding extremophile adaptation mechanisms?

The study of aq_2145 offers unique opportunities to elucidate molecular mechanisms of thermophilic adaptation, potentially revealing principles that could be applied to protein engineering and evolutionary biology:

Temperature adaptation insights:

  • Analysis of amino acid composition may reveal thermostability determinants

  • Identification of structural features that contribute to heat resistance

  • Elucidation of stability-flexibility relationships in functional proteins

  • Potential discovery of novel protein folding principles

Comparison of aq_2145 with mesophilic homologs could identify specific adaptations that enable function at extreme temperatures. Statistical analysis of amino acid preferences (e.g., increased presence of charged residues forming salt bridges, higher proportion of hydrophobic residues in the core) might reveal patterns that contribute to thermostability.

The uncharacterized nature of aq_2145 presents an opportunity to potentially discover novel adaptation mechanisms that have not been observed in previously characterized proteins. This research could expand our understanding of how life adapts to extreme environments and the limits of biological systems .

What methodological approaches address the challenges of reconciling in vitro and in vivo functional data for extremophilic proteins?

Reconciling in vitro and in vivo functional data for extremophilic proteins like aq_2145 presents unique challenges due to the difficulty of replicating extreme environmental conditions in laboratory settings:

In vitro to in vivo translation challenges:

  • Temperature discrepancies between assay conditions and native environment

  • Differences in cellular contexts (crowding, chaperones, cofactors)

  • Potential multi-functionality not captured in simplified assays

  • Post-translational modifications present in vivo but absent in vitro

Methodological solutions include:

ChallengeMethodological ApproachApplication to aq_2145
Temperature GapsHigh-temperature reaction vesselsStudy activity at 85-95°C
Cellular ContextReconstituted systems with cytoplasmic extractsInclude A. aeolicus extracts in assays
Multi-functionalityActivity profiling against diverse substratesTest various potential functions
PTMsMass spectrometry to identify modificationsCompare native vs. recombinant protein

Researchers should design experiments that systematically bridge the gap between controlled in vitro conditions and the complex native environment. This might include developing specialized equipment for high-temperature live-cell imaging or microfluidic systems that can maintain extremophilic conditions while allowing real-time observation of molecular processes .

How should researchers interpret conflicting experimental data regarding aq_2145?

When faced with conflicting experimental data regarding aq_2145, researchers should employ a systematic framework for resolution:

Data conflict resolution framework:

  • Context evaluation: Assess differences in experimental conditions (temperature, pH, buffer composition)

  • Methodological comparison: Analyze differences in techniques, sensitivity, and specificity

  • Sample preparation assessment: Compare protein purification methods, tags, and storage conditions

  • Biological variation consideration: Account for potential strain differences or genetic variations

  • Statistical re-analysis: Apply appropriate statistical methods to raw data when available

Specific recommendations for aq_2145 research include:

  • Maintaining detailed records of all experimental conditions, particularly temperature ranges used during each step

  • Using multiple orthogonal techniques to verify key findings

  • Developing standardized positive and negative controls specific to aq_2145 experiments

  • Establishing collaborative networks to independently verify controversial results

  • Creating open-access repositories for sharing raw data

When analyzing conflicting data, researchers should consider the possibility that apparent contradictions might reveal important biological insights about conditional functionality or context-dependent behavior of aq_2145. Documentation of experimental design according to established standards (e.g., using Completely Randomized Design principles) can help identify sources of variability .

What experimental designs are most appropriate for studying thermostable proteins like aq_2145?

When studying thermostable proteins like aq_2145, experimental designs must accommodate their unique properties while maintaining statistical rigor:

Recommended experimental designs include:

  • Completely Randomized Design (CRD):

    • Appropriate when testing single factors affecting aq_2145 stability or function

    • Requires homogeneous experimental units

    • Allows flexible replication numbers across different treatments

    • Analysis through standard ANOVA procedures

    • Most suitable for controlled laboratory studies of purified aq_2145

  • Randomized Block Design (RBD):

    • Useful when natural variability exists in experimental batches

    • Each treatment appears in each block (e.g., protein purification batch)

    • Reduces error variance by accounting for batch effects

    • Particularly valuable when comparing aq_2145 to other proteins

  • Latin Square Design (LSD):

    • Appropriate when controlling for two sources of variation

    • Useful for complex assays with multiple variables

    • Example: Testing aq_2145 across different temperatures and pH values

    • Efficient use of experimental resources while maintaining statistical power

For thermostable proteins specifically, experimental designs should incorporate temperature as a controlled variable rather than a fixed condition. This allows for systematic exploration of temperature-dependent effects on structure, stability, and function.

How can researchers optimize the analysis of thermal stability data for aq_2145?

Thermal stability analysis of hyperthermophilic proteins like aq_2145 requires specialized approaches to accurately capture their unique properties:

Recommended analytical methods include:

  • Differential Scanning Calorimetry (DSC):

    • Extended temperature ranges (up to 120°C) required

    • Multiple heating/cooling cycles to assess reversibility

    • Calculation of thermodynamic parameters (ΔH, ΔS, ΔG)

    • Statistical analysis of replicate measurements (n≥3)

  • Circular Dichroism (CD) Thermal Melts:

    • Monitoring at multiple wavelengths (208, 222, 230 nm)

    • Gradual temperature ramping (0.5-1°C/min)

    • Two-state or multi-state unfolding model fitting

    • Baseline correction critical for accurate Tm determination

  • Thermofluor/Differential Scanning Fluorimetry:

    • Modified protocols for high Tm proteins

    • Alternative dyes for extreme temperature ranges

    • Controls with known thermostable proteins

    • Statistical treatment of melt curves

Data analysis should:

  • Apply appropriate curve-fitting algorithms for hyperthermophilic proteins

  • Use statistical methods that account for the non-normal distribution often observed in thermal stability data

  • Report confidence intervals rather than simple standard deviations

  • Consider potential systematic errors in temperature calibration at extreme ranges

Given the expected high thermal stability of aq_2145, researchers should ensure that control experiments establish the upper detection limits of their analytical methods and validate that observed transitions represent actual protein unfolding rather than instrument artifacts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.