Recombinant Aquifex aeolicus Uncharacterized protein aq_2157 (aq_2157)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your requests as best as possible.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing your preferred tag.
Synonyms
aq_2157; Uncharacterized protein aq_2157
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
aq_2157
Target Protein Sequence
MLVPQDYRIPFGIGYLLGTFFLSPDLDLHFSKPSQRWKFLKFLWFPFWVFSRHRGITHVP FLGTLVKLFYLIFIFFFLYFAVLGVLSILGFAPKELLSFDPFAFINEFLKSEKGFFFILG LIVADLLHIVLDIVSSFIKRF
Uniprot No.

Target Background

Database Links

KEGG: aae:aq_2157

STRING: 224324.aq_2157

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does aq_2157 relate to other proteins in the Aquifex aeolicus proteome?

While specific homology data for aq_2157 is limited, it represents one of many uncharacterized proteins in the Aquifex aeolicus proteome. This organism's genome contains numerous proteins of unknown function that may play crucial roles in its unique metabolic adaptations. Unlike more characterized proteins such as Aq1575, which belongs to the DUF28 domain family and has had its crystal structure determined, aq_2157 remains largely unexplored structurally and functionally . Phylogenetic analysis would likely require comparative genomics approaches using tools like BLAST against the proteomes of other hyperthermophiles to establish evolutionary relationships.

What computational predictions exist for aq_2157's function?

Based on sequence analysis, aq_2157 likely contains multiple transmembrane regions, suggesting it may function as a membrane protein. Hydropathy plotting would predict 3-4 potential membrane-spanning domains. Computational tools such as InterPro, Pfam, and CATH can be employed to identify potential functional domains, though results may be limited due to the protein's uncharacterized nature. Secondary structure prediction algorithms would likely indicate predominant alpha-helical structures in the hydrophobic regions. These computational approaches provide starting hypotheses for experimental verification through techniques like site-directed mutagenesis of conserved residues.

What expression systems are optimal for recombinant production of aq_2157?

For thermostable proteins like aq_2157, E. coli BL21(DE3) remains the primary expression system, but with several critical modifications:

Expression SystemAdvantagesChallengesRecommendations
E. coli BL21(DE3)High yield, established protocolsPotential misfolding due to thermophilic originUse chaperone co-expression (GroEL/ES)
E. coli RosettaBetter handling of rare codonsLower yields than BL21Useful if codon optimization is not performed
Insect cellsBetter for membrane proteinsHigher cost, longer production timeConsider for functional studies requiring native folding

Expression optimization should include testing multiple fusion tags (His6, MBP, SUMO) as thermophilic proteins often require specialized handling. Lower induction temperatures (16-20°C) despite the thermophilic origin often improve soluble yield by slowing protein synthesis and folding. For aq_2157, codon optimization for E. coli is recommended due to the significant codon usage differences between Aquifex and E. coli .

What purification strategies are effective for obtaining high-quality aq_2157 samples?

Purification of aq_2157 requires strategies accounting for its likely membrane association and thermostability:

  • Initial extraction: If membrane-associated, use mild detergents like DDM or LDAO rather than harsh denaturants.

  • IMAC purification: Utilize a His-tag for initial capture, but ensure buffers contain appropriate detergents.

  • Size exclusion chromatography: Critical for removing aggregates and ensuring monodispersity.

  • Thermal stability testing: Perform differential scanning fluorimetry (DSF) to identify stabilizing buffer conditions.

For structural studies requiring highly pure protein, employ a multi-step approach including ion exchange chromatography as a polishing step. The buffer composition should be optimized through thermal shift assays, typically including stabilizing agents like glycerol or specific salts that improve thermostability. Purification quality can be assessed through analytical size exclusion chromatography to ensure monodispersity .

What structural characterization methods are appropriate for aq_2157?

Structural characterization of aq_2157 should employ a multi-technique approach:

MethodApplicationResolutionSample Requirements
X-ray CrystallographyHigh-resolution structure determinationAtomic (1-3Å)Highly pure, crystallizable protein (5-10mg)
Cryo-EMStructure determination without crystalsNear-atomic (2.5-4Å)Pure, homogeneous samples (50-100μg)
NMR SpectroscopySolution structure, dynamicsAtomic for small proteins15N/13C-labeled protein (2-5mg/ml)
CD SpectroscopySecondary structure contentLow (identifies α-helix/β-sheet content)0.1-0.5mg/ml protein

Given the small size of aq_2157 (141 amino acids) and potential membrane association, a combination of solution NMR for structural determination and molecular dynamics simulations would be particularly effective. The approach used for Aq1575, which determined its crystal structure revealing a unique fold with three domains arranged along a pseudo-threefold symmetry axis, provides a precedent for structural studies of Aquifex aeolicus proteins .

How can the potential metabolic role of aq_2157 be investigated?

Investigating the metabolic context of aq_2157 requires integration of multiple approaches:

  • Co-expression analysis: Identify genes co-regulated with aq_2157 in Aquifex aeolicus to establish metabolic context.

  • Metabolic network analysis: Analyze the whole-genome metabolic network of A. aeolicus (containing approximately 756 reactions and 729 metabolites) to identify network gaps where aq_2157 might function .

  • Knockout/knockdown studies: Generate conditional expression systems in A. aeolicus or heterologous hosts to observe phenotypic changes.

  • Metabolomics profiling: Compare metabolite profiles in normal and aq_2157-depleted conditions.

Phylometabolic analysis (PMA) should be employed to integrate metabolic and phylogenetic constraints, as this approach has proven valuable for reconstructing the evolutionary history of metabolic networks in deep-branching organisms like A. aeolicus . Such analyses can identify the most likely metabolic subsystems in which aq_2157 participates.

What evolutionary insights might aq_2157 provide about early metabolic systems?

As A. aeolicus is one of the deepest-branching bacteria known, studying aq_2157 may provide insights into early protein evolution:

  • Comparative genomics: Identify homologs across the tree of life, particularly in other deep-branching thermophiles like Thermotoga maritima.

  • Reconstruction of ancestral sequences: Apply ancestral sequence reconstruction methods to infer evolutionary trajectories.

  • Domain analysis: Investigate whether aq_2157 represents a primitive form of a more specialized modern protein class.

A. aeolicus is recognized for using ancestral metabolic pathways, making it valuable for studying early metabolism . If aq_2157 is involved in core metabolic processes, it may represent an early evolutionary solution to fundamental biochemical challenges, potentially exhibiting lower substrate specificity than metabolically equivalent proteins in later-branching organisms.

What approaches can determine if aq_2157 exhibits thermoadaptive properties?

Investigating thermoadaptive properties should include:

  • Thermal stability assays: Determine melting temperature (Tm) using DSF or circular dichroism.

  • Activity measurements across temperature ranges: Establish temperature optima if enzymatic function is identified.

  • Comparative analysis with mesophilic homologs: Engineering chimeric proteins can identify specific thermostabilizing features.

  • Molecular dynamics simulations: Model structural flexibility at different temperatures.

A. aeolicus proteins typically exhibit adaptations such as increased ionic interactions, shortened loops, and hydrophobic core packing that contribute to thermostability . These features can be quantified and compared to mesophilic homologs to identify specific thermoadaptive elements in aq_2157.

How can aggregation issues during recombinant aq_2157 production be addressed?

Protein aggregation is a common challenge when working with thermophilic proteins expressed in mesophilic hosts:

ChallengeSolution StrategyImplementation
Inclusion body formationSolubility enhancementFuse with solubility tags (MBP, SUMO, TrxA)
Aggregation during purificationBuffer optimizationScreen additives (amino acids, polyols, detergents)
Concentration-dependent aggregationSurface engineeringIdentify and mutate surface hydrophobic patches
Thermal instability at low temperaturesStabilizing conditionsInclude osmolytes and specific ion pairs

For membrane-associated proteins like aq_2157 likely is, detergent screening is crucial. Start with a panel of 6-8 detergents ranging from harsh (SDS) to mild (DDM, CHAPS) to identify conditions that maintain the protein in a soluble, functional state. Additionally, consider nanodiscs or amphipols as alternatives to traditional detergents for maintaining native-like environments .

What strategies help resolve conflicting functional predictions for aq_2157?

When faced with contradictory functional predictions, employ a systematic approach:

  • Critical evaluation of prediction methods: Different algorithms have varying performance across protein families.

  • Consensus-based ranking: Prioritize predictions supported by multiple independent methods.

  • Experimental validation hierarchy: Design experiments that can discriminate between competing hypotheses.

  • Structure-guided functional testing: If structural data becomes available, use it to design targeted experiments.

For aq_2157, start with broad functional category testing (e.g., binding assays with different metabolite classes) before proceeding to specific enzymatic activity assays. The approach used for Aq1575, where structural analysis revealed potential active sites based on conserved residues in multiple sequence alignments, provides a good template for resolving functional ambiguities .

How might aq_2157 contribute to understanding hyperthermophilic adaptation mechanisms?

Understanding aq_2157 can provide insights into thermal adaptation through:

  • Comparative structural analysis: Identify unique structural features compared to mesophilic homologs.

  • Protein engineering platforms: Use thermostable features as design principles for engineering mesophilic proteins.

  • Environmental adaptation studies: Correlate protein features with the specific geochemical conditions of hydrothermal habitats.

A. aeolicus has evolved numerous adaptations to its extreme environment, including specific kinetic optimizations and thermodynamic efficiency improvements in its metabolic network . Studying aq_2157 as part of this system could reveal how individual proteins contribute to these organism-level adaptations.

What is the potential significance of aq_2157 in evolutionary studies of early metabolism?

Aq_2157 may provide important evolutionary insights through:

  • Identification of primitive protein features: If aq_2157 represents an early form of a more widespread protein family, it may retain ancestral features lost in modern proteins.

  • Metabolic network contextual analysis: Placement within the reconstructed ancestral metabolic network of A. aeolicus.

  • Horizontal gene transfer analysis: Determine if aq_2157 shows evidence of HGT, which is known to have occurred between Aquificales and ε-proteobacteria .

The study of A. aeolicus proteins is particularly valuable for understanding early metabolic evolution because this organism uses many reconstructed ancestral pathways . If aq_2157 is involved in core metabolism, it may represent an evolutionary innovation that contributed to the adaptation of early life to thermal environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.