Recombinant Aquifex aeolicus Uncharacterized protein aq_363 (aq_363)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant Aquifex aeolicus uncharacterized protein aq_363 (aq_363) is a synthetic version of a protein encoded by the aq_363 gene in the hyperthermophilic bacterium Aquifex aeolicus. This protein remains uncharacterized in terms of its biological function, structure, or interactions, but it is commercially available as a recombinant product for research purposes .

PropertyDetail
UniProt IDO66688
Host OrganismEscherichia coli
Protein LengthPartial (exact length unspecified; likely truncated for expression)
TagN-terminal His-tag (confirmed in some constructs)
Purity>85% (SDS-PAGE)
FormLyophilized powder or liquid (buffer-dependent)

Production and Biochemical Characteristics

aq_363 is produced via recombinant DNA technology, where the aq_363 gene is cloned into a plasmid and expressed in E. coli. Key biochemical features include:

  • Expression System: Bacterial (e.g., E. coli) with inducible promoters .

  • Purification: Affinity chromatography (e.g., His-tag binding) .

  • Stability: Sensitive to repeated freeze-thaw cycles; stable at -20°C/-80°C with glycerol .

  • Reconstitution: Recommended in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

Storage Buffer: Tris/PBS-based buffer with 6% trehalose (pH 8.0) .

Research Applications and Challenges

aq_363 serves as a tool for structural biology, biochemical assays, and functional genomics. Challenges include:

  • Limited Data: No studies on substrate binding, enzymatic activity, or protein interactions .

  • Structural Uncertainty: No crystallographic or NMR data available .

  • Functional Annotation: Requires high-throughput screening or genetic knockouts to elucidate roles.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Important: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. To maintain optimal quality, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
aq_363; Uncharacterized protein aq_363
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-143
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
aq_363
Target Protein Sequence
MIFMKELFLFLHVVLATFWVGGMLFLSLVVAPYLKDKPQIRNEAFQEVGKRFSLYGTFLS LFLLFVTGLVNTYLIQGGFRPSIHTKLGVFFVVVFISLLHDLWAGKKALYSEKHRVWAKW LGILNLILSLLLVYLGVRIRLGY
Uniprot No.

Target Background

Database Links

KEGG: aae:aq_363

STRING: 224324.aq_363

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the recommended storage conditions for recombinant aq_363 protein?

For optimal stability, store recombinant aq_363 protein at -20°C/-80°C, with lyophilized forms having a shelf life of approximately 12 months and liquid forms lasting about 6 months at these temperatures . The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . To prevent degradation, researchers should avoid repeated freeze-thaw cycles, as this can compromise protein integrity. For short-term usage (up to one week), working aliquots can be stored at 4°C .

How should recombinant aq_363 be reconstituted for experimental use?

The recommended reconstitution protocol for aq_363 is as follows:

  • Briefly centrifuge the vial before opening to ensure all content is at the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (standard recommendation is 50%)

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store aliquots at -20°C/-80°C for long-term storage

Proper reconstitution ensures protein stability and activity for downstream applications.

What analytical methods can confirm the purity and identity of recombinant aq_363?

The purity of commercially available recombinant aq_363 is typically greater than 90% as determined by SDS-PAGE analysis , though some sources report >85% purity . Researchers should independently verify protein quality using several complementary approaches:

  • SDS-PAGE to confirm molecular weight and purity

  • Western blotting using anti-His antibodies to verify tag presence

  • Mass spectrometry for accurate molecular weight determination and sequence coverage

  • N-terminal sequencing to confirm protein identity

  • Dynamic light scattering to assess aggregation state

These methods collectively provide comprehensive quality assessment before proceeding with functional or structural studies.

What experimental approaches can be used to determine the function of uncharacterized aq_363?

Determining the function of an uncharacterized protein like aq_363 requires a multi-faceted approach:

  • Bioinformatic analysis: Employ tools like BLAST, Pfam, and AlphaFold to identify potential homologs, conserved domains, and predicted structures. Examine transmembrane prediction algorithms given the sequence characteristics.

  • Structural studies: X-ray crystallography or cryo-EM approaches similar to those used for other A. aeolicus proteins . The crystal structure of related A. aeolicus proteins required specific conditions:

Crystal ParametersValues for A. aeolicus R1Values for A. aeolicus R2
Resolution (Å)2.701.73-2.15
Space groupP321P1211
Unit cell parametersa=b=188.0, c=115.8 ÅVariable depending on form
Temperature (K)100100
  • Protein-protein interaction studies: Investigate binding partners using pull-down assays, co-immunoprecipitation, or yeast two-hybrid systems.

  • Functional screening: Test for enzymatic activities related to membrane proteins or transport functions, given the sequence characteristics.

  • Localization studies: Determine cellular localization in A. aeolicus or heterologous systems to provide functional clues.

These approaches should be conducted at temperatures approximating the natural environment of A. aeolicus (approximately 79°C) for optimal activity .

How should researchers address the challenges of working with proteins from hyperthermophilic organisms?

Working with proteins from hyperthermophilic organisms like A. aeolicus presents unique challenges:

  • Stability assessment at different temperatures: Conduct differential scanning calorimetry to determine thermal stability ranges. A. aeolicus proteins typically show maximum activity at around 79°C, corresponding to the organism's natural environment .

  • Buffer optimization: Standard buffers may require modification for thermostability:

    • Use buffers with low temperature coefficients (e.g., phosphate)

    • Adjust pH accounting for temperature-dependent pKa shifts

    • Include stabilizing agents like glycerol or specific ions

  • Assay adaptation: Enzymatic assays should be conducted at elevated temperatures with appropriate controls. Account for increased rates of spontaneous chemical reactions at high temperatures.

  • Expression systems: While E. coli is commonly used , consider thermophilic expression hosts for proper folding of challenging proteins.

  • Structural analysis considerations: Include temperature factors in crystallographic analysis. The A. aeolicus R1 protein, for example, showed B-factors ranging from 59.4-90.2 Ų , indicating potential flexibility important for function.

What is the significance of metal binding in aq_363 function, and how can it be investigated?

While direct metal binding information for aq_363 is not provided in the search results, insights can be drawn from studies of other A. aeolicus proteins:

  • Metal content analysis: Use inductively coupled plasma mass spectrometry (ICP-MS) to quantify metal ions. Studies of A. aeolicus R2 protein revealed important iron occupancy differences between protein variants .

  • Spectroscopic approaches:

    • Electron paramagnetic resonance (EPR) for paramagnetic metals

    • UV-visible spectroscopy for transition metal detection

    • X-ray absorption spectroscopy for coordination environment

  • Metal dependency assays: Test activity in the presence of metal chelators or with supplementation of different metal ions.

  • Structural impact: Investigate how metal binding affects thermal stability, as seen in A. aeolicus R2 where iron incorporation appears crucial for protein integrity in low-oxygen environments .

  • Evolutionary context: Compare potential metal binding sites with those in homologous proteins from mesophilic organisms to identify adaptations for extreme environments.

Metal binding studies are particularly relevant since research on A. aeolicus R2 revealed that proper metal incorporation affects protein activity and may be essential for the organism's survival in its natural environment .

How does the His-tag affect structural and functional studies of aq_363?

The influence of the N-terminal His-tag on aq_363 requires careful consideration:

  • Structural impact assessment:

    • Circular dichroism to compare tagged vs. cleaved protein

    • Small-angle X-ray scattering to detect conformational changes

    • Crystallization trials with and without tag removal

  • Tag removal strategies:

    • Incorporate protease cleavage sites (TEV, thrombin)

    • Optimize cleavage conditions for thermostable proteins

    • Validate complete tag removal by mass spectrometry

  • Functional consequences:

    • Compare activity assays before and after tag removal

    • Assess binding affinities with potential partners

    • Investigate oligomerization differences

  • Controls for experiments:

    • Include His-tag-only peptides as controls in binding studies

    • Use alternative tag systems for validation (e.g., GST, MBP)

    • Perform experiments with tag placed at different positions

The potential influence of tags is particularly relevant as structural studies of A. aeolicus proteins have revealed unique oligomerization states that are critical for function, such as the α2β2 active complex and α4β4 inactive complex observed in A. aeolicus RNR .

What can aq_363 research contribute to understanding extremophile biology?

Studying uncharacterized proteins like aq_363 from extremophiles provides several scientific opportunities:

  • Evolutionary adaptations: Elucidating how proteins from hyperthermophiles like A. aeolicus maintain stability and function at extreme temperatures (optimally around 79°C) .

  • Novel structural motifs: Identifying unique structural features similar to the β-hairpin hook structure with π-stacking interactions found in A. aeolicus R1 protein, which may contribute to thermal stability .

  • Biocatalyst development: Understanding thermostable proteins can inform the design of industrial enzymes with enhanced stability and activity.

  • Minimal genome studies: A. aeolicus has a compact genome, making it valuable for understanding essential protein functions and minimal requirements for life in extreme environments.

  • Membrane adaptation mechanisms: Based on the amino acid sequence, aq_363 may have membrane-associated functions, potentially revealing adaptations for membrane integrity at high temperatures .

Research on uncharacterized proteins contributes to filling knowledge gaps in extremophile biology, potentially revealing novel biological mechanisms evolved for survival in harsh conditions.

What bioinformatic approaches can predict potential functions of aq_363?

Advanced bioinformatic strategies to predict aq_363 function include:

  • Sequence-based approaches:

    • Profile-profile alignments to detect remote homologs

    • Analysis of conserved residues across related bacteria

    • Transmembrane topology prediction given the high hydrophobicity in the amino acid sequence

    • Co-evolution analysis to identify functionally linked residues

  • Structure-based methods:

    • Homology modeling using related structures as templates

    • Binding site prediction and molecular docking

    • Electrostatic surface analysis to identify potential interaction interfaces

    • Molecular dynamics simulations at elevated temperatures

  • Systems biology integration:

    • Gene neighborhood analysis

    • Co-expression data examination

    • Pathway enrichment analysis

    • Protein-protein interaction network predictions

  • Machine learning approaches:

    • Function prediction using deep learning frameworks

    • Feature extraction from sequence and predicted structure

    • Transfer learning from characterized proteins

Given the lack of characterized homologs, researchers should employ multiple complementary methods and prioritize experimental validation of any predictions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.