Recombinant Aquifex aeolicus Uncharacterized protein aq_376 (aq_376)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
aq_376; Uncharacterized protein aq_376
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
aq_376
Target Protein Sequence
MEGIKVLAKQFGKIKTPQGLAVAIALITAIAWFPDGLAGFLPSLKSNPFQAIIGAILTIL GLSIIFFLHKKLRRGQKDSIIAEFGFIVLTLIFSLIVFNDFAITQFITSSLVFFSAWLHV REMEIVDYTVREVRPSNVKATVIFLSSAKYDEKFKKLMEKVEEIPTINDFFDFLEKEKMR LPWEMQLRLINEFSRSLKYVYVIGSVNSSSGSFEQIEDFKLIVNKFFPQIEVIKYREGLD FENLEKNFGVLKEIYSELKTKGLKEREIIIDTTGGQKIQSIAGALYSTAYDRFFAYVSTN SKSVKVFDVVPTE
Uniprot No.

Target Background

Database Links

KEGG: aae:aq_376

STRING: 224324.aq_376

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological context of Aquifex aeolicus from which aq_376 is derived?

Aquifex aeolicus is a model organism for the deeply rooted phylum Aquificae. This hyperthermophilic bacterium is characterized as a chemolithoautotrophic, Gram-negative, motile microorganism that thrives in extremely hot marine environments, typically between 85°C and 95°C near underwater volcanoes or hot springs .

A. aeolicus has a rod-shaped morphology with dimensions of approximately 2.0-6.0μm in length and 0.4-0.5μm in diameter. It is an H2-oxidizing microaerophile that can also utilize sulfur compounds commonly found in volcanic environments . The organism requires oxygen but grows optimally under microaerophilic conditions. A. aeolicus is particularly significant in evolutionary studies as it is believed to be one of the earliest diverging species of thermophilic bacteria .

Why are researchers interested in recombinant proteins from Aquifex aeolicus?

Researchers are drawn to A. aeolicus proteins for several compelling reasons:

  • Thermostability: A. aeolicus proteins possess hyper-stable characteristics due to the organism's adaptation to extreme temperatures, making them valuable for biotechnological applications requiring high-temperature stability .

  • Evolutionary significance: As one of the earliest diverging bacterial lineages, proteins from A. aeolicus provide valuable insights into the evolution of protein structure and function, potentially illuminating aspects of early life on Earth .

  • Unique structural properties: The proteins often exhibit distinctive folding and structural characteristics that enable function under extreme conditions, providing models for protein engineering .

  • Potential biotechnological applications: Many enzymes from A. aeolicus have been investigated for industrial and research applications where thermostability is advantageous .

  • Comparative biochemistry: Studying proteins like aq_376 allows researchers to understand adaptations to extreme environments at the molecular level .

How does the aq_376 protein relate to prokaryotic defense systems?

The aq_376 protein belongs to a group associated with ligand-binding regulatory functions in prokaryotic defense systems. Research indicates that members of the Aq_376 group contain characteristic inserts after strand-1 in their structure, which appears to be significant for their functional properties .

These proteins are believed to function within a broader context of nucleic acid-based immune systems. Current research suggests that the Aq_376 family may be involved in regulatory mechanisms related to CARF (CRISPR-associated Rossmann fold) domains, which are important components in prokaryotic defense systems . Though the exact function remains uncharacterized, its conservation across thermophilic bacteria suggests an important role in survival under extreme conditions.

What experimental approaches should be employed to determine the ligand-binding properties of aq_376?

When investigating the ligand-binding properties of aq_376, researchers should consider a multi-faceted experimental approach:

  • Structural analysis using X-ray crystallography or cryo-EM: These techniques can reveal the three-dimensional arrangement of the protein, particularly focusing on the inserts after strand-1 that may form part of a ligand-binding pocket .

  • Binding assays with predicted ligands: Based on structural similarities to other CARF domains, researchers should test binding with nucleotide and nucleotide-derived molecules using techniques such as:

    • Isothermal titration calorimetry (ITC)

    • Surface plasmon resonance (SPR)

    • Fluorescence-based binding assays

    • Pull-down assays with potential ligands

  • Site-directed mutagenesis: Modify key residues in the potential binding pocket, particularly those conserved among Aq_376 family members, to assess their importance in ligand binding .

  • Functional assays: Develop assays to measure regulatory activity in response to potential ligands, potentially using reconstituted systems or heterologous expression.

The presence of conserved pockets formed by residues from the strand-1 and strand-4 motifs suggests these regions are prime candidates for ligand interactions .

What are the challenges in expressing and purifying active recombinant aq_376 protein?

The expression and purification of active recombinant aq_376 present several significant challenges:

  • Thermophilic protein expression in mesophilic hosts: Expression in conventional E. coli systems may result in misfolding due to temperature incompatibility. Researchers should consider:

    • Using specialized expression strains adapted for thermophilic proteins

    • Optimizing growth conditions (temperature shifts, induction parameters)

    • Exploring expression in alternative hosts such as Thermus thermophilus

  • Maintaining stability during purification: The protein's native environment is extremely thermophilic, so standard purification protocols may need modification:

    • Include stabilizing agents in buffers

    • Consider heat treatment steps (75-85°C) to exploit thermostability while denaturing host proteins

    • Optimize buffer compositions based on A. aeolicus physiological conditions

  • Proper tag selection: The N-terminal 10xHis-tag used in commercial preparations may affect function or structure. Researchers should:

    • Test multiple tag configurations (N-terminal, C-terminal, or cleavable tags)

    • Verify that the tag doesn't interfere with structural elements or binding sites

    • Consider tag-free purification methods if possible

  • Confirming proper folding: Verification steps should include:

    • Circular dichroism spectroscopy to assess secondary structure

    • Thermal stability assays to confirm expected thermostability

    • Activity assays with predicted ligands or interaction partners

What techniques are most effective for analyzing the potential regulatory function of aq_376?

To thoroughly investigate the regulatory function of aq_376, researchers should employ a comprehensive set of techniques:

  • Comparative genomic analysis: Examine the genomic context of aq_376 in A. aeolicus and related species to identify potential associated genes in the same operon or regulatory network .

  • Protein-protein interaction studies:

    • Bacterial two-hybrid assays adapted for thermophilic proteins

    • Co-immunoprecipitation with predicted interaction partners

    • Cross-linking mass spectrometry to identify transient interactions

  • Transcriptional regulation analysis:

    • RNA-seq before and after environmental stress conditions

    • Chromatin immunoprecipitation (if DNA binding is suspected)

    • In vitro transcription assays with purified components

  • Structural biology approaches:

    • Crystallize the protein with and without potential ligands

    • NMR for dynamic binding studies

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes upon ligand binding

  • Functional assays in reconstituted systems:

    • Develop assays for potential enzymatic activity

    • Test for effects on CRISPR-Cas or other defense systems if genomic context suggests this connection

How can researchers distinguish between the potential roles of aq_376 in CRISPR systems versus other cellular functions?

Distinguishing between CRISPR-related and alternative cellular functions requires several targeted experimental approaches:

  • Genetic context analysis:

    • Map the genomic neighborhood of aq_376 to identify proximity to CRISPR arrays or cas genes

    • Compare this organization across different species containing aq_376 homologs

    • Construct a phylogenetic profile of aq_376 presence/absence versus CRISPR system types

  • Gene deletion or silencing studies:

    • Create knockout or knockdown strains (if genetic tools are available for A. aeolicus or model organisms with aq_376 homologs)

    • Assess phenotypes under normal and phage challenge conditions

    • Measure CRISPR activity with and without functional aq_376

  • Biochemical interaction assays:

    • Test direct binding to CRISPR components (Cas proteins, crRNA)

    • Investigate interactions with nucleic acids and nucleotide derivatives

    • Perform activity assays in the presence of CRISPR components

  • Comparative function analysis:

    Experimental ApproachCRISPR-Related FunctionAlternative Cellular Function
    Phage challenge assayAltered susceptibilityNo change in phage resistance
    Growth under stressNormal growthGrowth defects under specific conditions
    Interacting partnersCas proteins, crRNAsMetabolic enzymes, regulatory proteins
    Inducing conditionsViral exposureMetabolic shifts, environmental stress
    Ligand specificityNucleic acid fragmentsMetabolites, signaling molecules

What structural features of aq_376 contribute to its thermostability and how can they be investigated?

The thermostability of aq_376, like other A. aeolicus proteins, likely stems from several structural adaptations that can be investigated using these approaches:

  • Sequence-based analysis:

    • Identify increased proportions of charged residues (especially Glu, Arg, Lys)

    • Calculate hydrophobic core content compared to mesophilic homologs

    • Analyze distribution of glycine and proline residues that affect backbone flexibility

  • Structural investigations:

    • X-ray crystallography at different temperatures

    • Molecular dynamics simulations to identify stabilizing interactions

    • Hydrogen-deuterium exchange to identify regions of exceptional stability

  • Thermal stability assays:

    • Differential scanning calorimetry to determine melting temperatures

    • Circular dichroism with temperature ramping

    • Activity measurements at increasing temperatures

  • Comparative mutagenesis:

    • Create variants where thermostabilizing features are replaced with corresponding residues from mesophilic homologs

    • Measure changes in stability and activity

    • Perform reverse mutations in mesophilic homologs to increase their stability

  • Structural features to investigate:

    FeatureContribution to ThermostabilityInvestigation Method
    Salt bridgesElectrostatic stabilizationStructure analysis and mutation of charged residues
    Hydrophobic coreReduced solvent exposureMeasure core packing density in crystal structures
    Disulfide bondsCovalent stabilizationReducing/non-reducing comparisons
    Loop stabilizationReduced entropyAnalysis of B-factors in crystal structures
    Surface chargeSolubility at high temperaturesElectrostatic surface mapping

How does aq_376 relate to similar proteins in other extremophiles, and what does this tell us about protein evolution?

The evolutionary relationships of aq_376 provide valuable insights into protein adaptation to extreme environments:

  • Phylogenetic analysis:

    • Construct phylogenetic trees of aq_376 homologs across bacterial and archaeal species

    • Correlate protein sequence features with environmental niches

    • Identify potential horizontal gene transfer events, which are common in A. aeolicus

  • Comparative structural analysis:

    • Analyze conservation patterns in the inserts after strand-1 characteristic of the Aq_376 group

    • Compare binding pocket architectures across thermophilic and mesophilic homologs

    • Identify structural elements conserved specifically in extremophile versions

  • Adaptation signatures:

    • Perform positive selection analysis to identify residues under evolutionary pressure

    • Compare amino acid composition biases between extremophile and mesophilic variants

    • Assess co-evolution networks within the protein structure

The analysis of Aquifex RNase P revealed evidence of horizontal gene transfer from Archaea to Bacteria , suggesting that similar patterns might be observed for aq_376, particularly if it has a role in defense systems that are frequently horizontally transferred.

What methods should be used to identify the physiological substrates or interaction partners of aq_376?

Identifying the native substrates or partners of aq_376 requires a multi-faceted approach:

  • In silico prediction methods:

    • Structural modeling to identify potential binding pockets

    • Docking studies with candidate ligands, particularly nucleotide derivatives

    • Network analysis of co-occurrence patterns across genomes

  • Untargeted binding assays:

    • Affinity purification followed by mass spectrometry to identify bound molecules

    • Ligand-observed NMR screening with fragment libraries

    • Thermal shift assays with metabolite libraries

  • Validation methods:

    • Isothermal titration calorimetry with candidate ligands

    • Surface plasmon resonance for binding kinetics

    • Functional assays measuring activity in response to potential ligands

  • Physiological context studies:

    • Investigate expression patterns under different growth conditions

    • Determine subcellular localization

    • Identify conditions that alter aq_376 abundance or modification state

  • Co-crystal structure determination:

    • Attempt crystallization in the presence of potential ligands identified in screening

    • Analyze binding pocket interactions and conformational changes

Given the relation to CARF domains , nucleotide-derived molecules are strong candidates for native ligands, particularly those that might be produced during viral infection or cellular stress.

How can aq_376 inform our understanding of protein structure-function relationships under extreme conditions?

The aq_376 protein provides a valuable model for studying structural adaptations to extreme environments:

What are the optimal conditions for the expression and purification of recombinant aq_376?

Successful expression and purification of recombinant aq_376 requires careful optimization:

  • Expression system selection:

    • E. coli BL21(DE3) typically provides good yields for thermostable proteins

    • Consider specialized strains for problematic expressions (Rosetta for rare codons, Origami for disulfide bonds)

    • The commercial preparation uses an N-terminal 10xHis-tag , which appears effective

  • Expression conditions:

    • Lower induction temperatures (15-25°C) often improve folding despite the protein being thermostable

    • Extended induction times (overnight) at lower temperatures may increase yields

    • IPTG concentration optimization (typically 0.1-0.5 mM)

  • Purification strategy:

    • Initial capture using Ni-NTA affinity chromatography for His-tagged protein

    • Heat treatment (70-80°C) to exploit thermostability and remove host proteins

    • Ion exchange chromatography as a polishing step

    • Size exclusion chromatography to ensure homogeneity and remove aggregates

  • Buffer optimization:

    Purification StageBuffer CompositionPurpose
    LysisTris/PBS-based, pH 8.0, with protease inhibitorsCell disruption while preventing degradation
    Affinity purificationTris/PBS with 20-40 mM imidazoleReduce non-specific binding
    ElutionTris/PBS with 250-500 mM imidazoleEfficient elution of target protein
    StorageTris/PBS with 6% Trehalose, pH 8.0 Stabilization during storage
  • Storage considerations:

    • Lyophilization is an effective preservation method for this thermostable protein

    • For liquid storage, aliquoting and storage at -20°C/-80°C is recommended

    • Avoid repeated freeze-thaw cycles as indicated for the commercial preparation

What controls and validation methods are essential when studying the potential role of aq_376 in defense mechanisms?

Robust experimental design for investigating aq_376's role in defense mechanisms requires appropriate controls and validation:

  • Essential negative controls:

    • Inactive mutant versions of aq_376 (targeting predicted functional residues)

    • Structurally similar proteins without the specific inserts found in the Aq_376 group

    • Reactions without potential ligands or interaction partners

  • Positive controls:

    • Well-characterized CARF domain proteins with known functions, if available

    • Other defense system components with established activities

    • Synthetic positive controls for activity assays

  • Validation approaches:

    • Multiple, orthogonal methods to confirm interactions or activities

    • Dose-response relationships for ligand binding and functional assays

    • In vivo phenotypic confirmation of in vitro findings

  • Addressing potential confounding factors:

    • Protein aggregation at experimental temperatures

    • Non-specific binding due to charge interactions

    • Buffer component interference with activity assays

    • Potential co-purifying factors from expression hosts

  • Reproducibility measures:

    • Independent protein preparations from different expression batches

    • Statistical analysis of replicate experiments

    • Validation in different experimental systems where possible

How should researchers design experiments to resolve contradictory findings about aq_376 function?

When faced with contradictory results regarding aq_376 function, researchers should implement systematic troubleshooting:

  • Identify sources of variation:

    • Different expression constructs (tag position, length, linker sequences)

    • Varied purification methods affecting protein conformations

    • Differences in experimental conditions (temperature, pH, salt concentration)

    • Different assay readouts measuring distinct aspects of activity

  • Systematic parameter testing:

    • Create a matrix of experimental conditions to identify variables affecting results

    • Test activity across different pH and temperature ranges

    • Evaluate effects of various buffer components and additives

  • Resolution strategies:

    • Direct comparison experiments with samples prepared by different methods

    • Blind testing of samples by independent researchers

    • Development of standardized protocols based on successful conditions

  • Multidisciplinary approaches:

    • Combine biochemical, structural, and genetic approaches

    • Correlate in vitro findings with in vivo observations

    • Use computational modeling to reconcile apparently contradictory results

  • Critical evaluation of assumptions:

    • Revisit the fundamental hypothesis about protein function

    • Consider multiple simultaneous functions depending on conditions

    • Evaluate potential post-translational modifications or heterogeneity in protein preparations

What emerging technologies could advance our understanding of aq_376 function?

Several cutting-edge technologies hold promise for elucidating aq_376 function:

  • Cryo-electron microscopy:

    • High-resolution structural determination without crystallization

    • Visualization of aq_376 in complex with potential interaction partners

    • Structural studies under conditions mimicking the native environment

  • Single-molecule approaches:

    • FRET to monitor conformational changes upon ligand binding

    • Single-molecule enzymology to detect potential catalytic activities

    • Optical tweezers to measure mechanical properties of protein-ligand interactions

  • Native mass spectrometry:

    • Detection of non-covalent complexes under near-native conditions

    • Identification of weakly bound ligands

    • Analysis of conformational dynamics

  • Advanced computational methods:

    • AlphaFold2 and RoseTTAFold for structure prediction of complexes

    • Molecular dynamics simulations at elevated temperatures

    • Machine learning approaches to predict functional partners based on genomic context

  • CRISPR-based genetic tools:

    • Development of genetic manipulation methods for A. aeolicus

    • CRISPRi for gene silencing without complete knockout

    • CRISPR screens to identify genetic interactions

These emerging technologies could help resolve the function of this uncharacterized protein within the context of A. aeolicus biology and potentially within prokaryotic defense systems.

How might the properties of aq_376 be exploited for biotechnological applications?

The unique properties of aq_376 suggest several potential biotechnological applications:

  • Thermostable molecular tools:

    • If binding properties are confirmed, development as a detection reagent for specific nucleotides

    • Potential use as a thermostable affinity tag for purification at high temperatures

    • Application in biosensors designed to function in extreme environments

  • Protein engineering platform:

    • Use as a thermostable scaffold for directed evolution of novel functions

    • Identification of stabilizing elements that could be transferred to other proteins

    • Development of chimeric proteins combining aq_376 stability with functional domains

  • Defense system biotechnology:

    • If confirmed as part of a defense system, potential development as an antiviral tool

    • Possible applications in microbial containment or self-destruct mechanisms

    • Use in synthetic biology circuits requiring environmental sensing

  • Structural biology applications:

    • Use as a model system for studying protein adaptation to extreme conditions

    • Development as a crystallization chaperone for difficult-to-crystallize proteins

    • Application in teaching and research demonstrations of protein thermostability

  • Industrial process applications:

    • Potential development as a thermostable catalyst if enzymatic activity is discovered

    • Use in high-temperature bioprocessing if regulatory functions are confirmed

    • Application in environmental monitoring of volcanic or geothermal sites

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.