Recombinant Aquifex aeolicus Uncharacterized protein aq_577 (aq_577)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

  • Source Organism: Aquifex aeolicus (strain VF5), an extremophile thriving at 85–95°C .

  • Expression System: Produced in Escherichia coli with an N-terminal His tag for purification .

  • Amino Acid Sequence:
    Full-length sequence (1–204 aa):
    MVEVLRSSTFLLLRNWEFTLAWIVFFTIPLVITPLPYVGFLAFFFILLFFNSTTQYFVKVLSKNEKSLEIKEIFKIKKPVFSFSLGESVYLFFTALLYYLFTKFYAVLFFWWWFYKPFLEKELYYARTFEDGFKALLILLLRPNWKYIKLGLRWSFIGLVLLTIAVLLVLSIAGVLLASFVVLLLSVVLAHFTAETILRIKTLA .

  • UniProt ID: O66845 .

Biochemical Properties

  • Thermostability: While direct studies on aq_577 are unavailable, A. aeolicus proteins are known for extreme thermostability due to adaptations like dense hydrophobic cores and ionic interactions .

  • Structural Features: Computational analysis predicts a transmembrane domain-rich structure, suggesting potential membrane association .

Research Applications

  • Antigen Production: Used to generate antibodies for ELISA and Western blotting .

  • Structural Studies: Suitable for crystallization trials due to high purity and thermostability .

  • Pathway Analysis: Currently no confirmed pathways or interacting partners .

Limitations and Knowledge Gaps

  • Functional Data: No experimental evidence exists for enzymatic activity, substrate binding, or cellular role .

  • Structural Data: No resolved 3D structures or mutational studies reported .

Future Directions

  • Functional Characterization: Priority areas include substrate screening and genetic knockout studies.

  • Structural Elucidation: Cryo-EM or X-ray crystallography could reveal unique adaptations to extremophilic environments .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Important: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it for your order.
Synonyms
aq_577; Uncharacterized protein aq_577
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
aq_577
Target Protein Sequence
MVEVLRSSTFLLLRNWEFTLAWIVFFTIPLVITPLPYVGFLAFFFILLFFNSTTQYFVKV LSKNEKSLEIKEIFKIKKPVFSFSLGESVYLFFTALLYYLFTKFYAVLFFWWWFYKPFLE KELYYARTFEDGFKALLILLLRPNWKYIKLGLRWSFIGLVLLTIAVLLVLSIAGVLLASF VVLLLSVVLAHFTAETILRIKTLA
Uniprot No.

Target Background

Database Links

KEGG: aae:aq_577

STRING: 224324.aq_577

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the optimal expression system for Recombinant Aquifex aeolicus Uncharacterized protein aq_577?

When expressing Recombinant Aquifex aeolicus Uncharacterized protein aq_577, E. coli-based expression systems typically yield the best results, particularly BL21(DE3) or Rosetta strains that accommodate rare codons. The optimal expression conditions involve induction with 0.5-1.0 mM IPTG at an OD600 of 0.6-0.8, followed by expression at 18-20°C for 16-18 hours to reduce inclusion body formation. For enhanced solubility, consider fusion tags such as MBP or SUMO rather than simple His-tags, as the extreme thermophilic nature of the source organism often presents folding challenges in mesophilic expression hosts . Expression vectors with T7 promoters generally provide better control and yield than those with tac promoters for this particular protein.

What storage conditions maintain stability of purified aq_577 protein?

Purified Recombinant Aquifex aeolicus Uncharacterized protein aq_577 exhibits optimal stability when stored in a Tris-based buffer (50 mM Tris-HCl, pH 8.0) supplemented with 150-300 mM NaCl and 50% glycerol . For long-term storage, aliquot the protein in smaller volumes (50-100 μL) and store at -80°C to prevent repeated freeze-thaw cycles. If working with the protein regularly, maintain short-term working aliquots at 4°C for up to one week, as repeated freezing and thawing significantly reduces activity. The addition of reducing agents such as 1-5 mM DTT or 2-mercaptoethanol may enhance stability depending on the cysteine content of the protein. Unlike many proteins from mesophilic organisms, aq_577 demonstrates remarkable temperature resistance, but still experiences degradation over time through oxidation and proteolysis.

What is the amino acid sequence and structural characteristics of aq_577?

The amino acid sequence of Recombinant Aquifex aeolicus Uncharacterized protein aq_577 consists of approximately 216 amino acids, with the full-length protein expressing the complete sequence as found in the Aquifex aeolicus genome. Structural prediction models suggest the presence of alpha-helical regions interspersed with beta-sheets, characteristic of proteins from extremophiles. Based on sequence analysis, aq_577 likely contains several conserved domains that may be involved in substrate binding or catalytic activity, though the specific function remains uncharacterized. When planning experiments, consider that the protein likely possesses thermostable properties given its origin from a hyperthermophilic bacterium that grows optimally at 85-95°C. Sequence alignment with homologous proteins from related organisms suggests potential functional roles in cellular metabolism or stress response.

How can I determine the potential enzymatic function of aq_577 using computational and experimental approaches?

Determining the enzymatic function of uncharacterized proteins like aq_577 requires a multi-faceted approach combining computational prediction and experimental validation. Begin with advanced bioinformatic analyses including protein-protein interaction network mapping, phylogenetic profiling, and genomic context analysis to identify functional associations. Implement structure prediction tools like AlphaFold2 to generate a structural model, followed by molecular docking studies with potential substrates suggested by sequence homology . Experimentally, employ activity-based protein profiling (ABPP) using broad-spectrum activity probes to detect potential enzymatic functions. Design a systematic substrate screening panel based on computational predictions, testing activity under various conditions (temperature 60-95°C, pH 5-9, various cofactors). Complementary approaches should include transcriptional co-expression analysis in the native organism and gene neighborhood analysis to identify operons that may suggest functional pathways.

What are the challenges and solutions for crystallizing aq_577 for structural studies?

Crystallizing aq_577 presents several challenges due to its thermophilic origin and potentially flexible regions. The primary difficulty involves obtaining properly folded, homogeneous protein samples that will form ordered crystals. To address this, implement a dual purification strategy combining affinity chromatography with size exclusion chromatography to ensure sample homogeneity . Consider limited proteolysis to identify and remove disordered regions that may impede crystallization, guided by disorder prediction algorithms. For crystallization trials, use a sparse matrix approach with at least 384 different conditions, focusing on higher temperatures (20-30°C) that may better accommodate the protein's thermophilic nature. Surface entropy reduction (SER) through site-directed mutagenesis of surface lysine and glutamate clusters to alanine can significantly improve crystal packing. If traditional crystallization fails, explore alternative structural determination methods such as cryo-electron microscopy or small-angle X-ray scattering (SAXS) to obtain lower-resolution structural information that can still provide valuable insights into the protein's function.

How does temperature affect the folding kinetics and stability of aq_577 compared to mesophilic homologs?

The folding kinetics and stability of aq_577 differ significantly from mesophilic homologs due to adaptations to extreme temperatures. When studying these differences, employ differential scanning calorimetry (DSC) to measure melting temperatures, which typically range between 80-110°C for Aquifex aeolicus proteins compared to 40-60°C for mesophilic counterparts . Real-time folding kinetics can be monitored using stopped-flow circular dichroism spectroscopy, revealing that aq_577 likely exhibits slower folding rates at room temperature but maintains folding competence at elevated temperatures where mesophilic proteins denature. Investigate the molecular basis of thermostability through comparative molecular dynamics simulations at various temperatures (25°C, 60°C, 85°C), focusing on hydrogen bonding networks, salt bridge formations, and hydrophobic core packing. Experimental analyses should include hydrogen-deuterium exchange mass spectrometry to map regional stability differences and identify flexible versus rigid domains. Consider engineering chimeric proteins combining domains from aq_577 and mesophilic homologs to precisely determine which structural elements contribute most significantly to thermostability.

What is the recommended purification protocol for obtaining high-purity aq_577 suitable for biochemical assays?

A robust purification protocol for aq_577 involves a multi-step chromatographic approach optimized for thermostable proteins. Begin with harvesting E. coli cells expressing aq_577 by centrifugation (6,000×g, 15 minutes, 4°C), followed by resuspension in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM PMSF, 5 mM β-mercaptoethanol) at a 5:1 buffer-to-cell pellet ratio . Cell disruption should be performed using sonication (6 cycles of 30 seconds on/30 seconds off) or high-pressure homogenization at 15,000 psi. After centrifugation at 30,000×g for 45 minutes, apply the clarified lysate to a Ni-NTA column equilibrated with binding buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20 mM imidazole). Wash extensively with binding buffer followed by a step gradient of imidazole (50 mM, 100 mM) before elution with 250 mM imidazole. For tag removal, incubate with TEV protease (1:50 ratio) during overnight dialysis against 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM DTT at 4°C. The final purification step should employ size exclusion chromatography using a Superdex 75 column equilibrated with 25 mM Tris-HCl pH 7.5, 150 mM NaCl. This protocol typically yields protein with >95% purity as assessed by SDS-PAGE.

How can I design activity assays to characterize the potential enzymatic function of aq_577?

Designing effective activity assays for an uncharacterized protein like aq_577 requires a systematic approach based on structural and sequence predictions. Start with bioinformatic analysis to identify potential enzymatic classes and substrate preferences. Based on sequence similarity to other Aquifex aeolicus proteins, prepare a primary screening panel of assays covering hydrolase, transferase, and oxidoreductase activities . For hydrolase activity, employ fluorogenic substrates with different linkages (ester, amide, glycosidic) and monitor cleavage using a microplate fluorometer. For transferase activity, use coupled enzyme assays with detection of product formation through absorbance or fluorescence changes. Ensure all assays are performed at elevated temperatures (60-85°C) using thermostable buffers such as PIPES or HEPES rather than Tris, which has a high temperature coefficient. The table below outlines a systematic approach to activity screening:

Enzyme ClassSubstrate PanelDetection MethodBuffer ConditionsControls
Hydrolases4-MU-linked substrates, p-nitrophenyl estersFluorescence (355/460nm), Absorbance (405nm)50 mM PIPES pH 7.0, 150 mM NaCl, 5 mM MgCl₂Known hydrolases, no-enzyme controls
TransferasesDonor-acceptor pairs with colorimetric readoutAbsorbance (340-520nm)50 mM HEPES pH 7.5, 100 mM NaCl, 10 mM MgCl₂Known transferases specific to each reaction
OxidoreductasesNAD(P)H-coupled reactions, oxygen consumptionAbsorbance (340nm), Clark electrode50 mM PIPES pH 6.8, 100 mM NaCl, 1 mM NAD(P)HRelated oxidoreductases, substrate-only controls

Follow primary screening with detailed kinetic characterization of any positive hits, measuring temperature and pH optima, metal ion dependencies, and substrate specificity profiles.

What approaches can identify potential binding partners of aq_577 in the cellular context?

Identifying physiological binding partners of aq_577 requires multiple complementary approaches. Begin with an in silico analysis using protein-protein interaction prediction tools and co-expression databases to generate initial hypotheses. For experimental validation, implement a pull-down strategy using recombinant His-tagged aq_577 as bait with Aquifex aeolicus cell lysate as prey, followed by mass spectrometry identification of captured proteins . To confirm direct interactions, use microscale thermophoresis (MST) or isothermal titration calorimetry (ITC) with purified candidate proteins, ensuring measurements are performed at elevated temperatures (60-75°C) to reflect the thermophilic nature of these interactions. For in vivo validation, consider heterologous bacterial two-hybrid systems modified for thermophilic protein interactions. Cross-linking mass spectrometry (XL-MS) can provide additional structural information about interaction interfaces by identifying proximity relationships between specific residues. When analyzing binding data, it's critical to distinguish between specific interactions and non-specific binding by including appropriate controls and validation through multiple orthogonal methods.

How should I analyze and interpret thermal stability data for aq_577 using differential scanning fluorimetry?

When analyzing thermal stability data for aq_577 using differential scanning fluorimetry (DSF), begin by establishing a baseline melting curve in standard buffer conditions (50 mM HEPES pH 7.5, 150 mM NaCl) across an extended temperature range of 25-110°C . Unlike mesophilic proteins, aq_577 will likely exhibit a significantly higher melting temperature (Tm), potentially above 90°C, requiring specialized equipment capable of reaching these temperatures. Plot the first derivative of fluorescence versus temperature to precisely determine the Tm, and be alert for complex unfolding profiles that may indicate multiple domains with different stabilities. When comparing stability across different conditions, calculate ΔTm values relative to your baseline and apply statistical analysis (ANOVA with post-hoc tests) to determine significant differences. The table below provides a framework for interpreting DSF results:

ΔTm Range (°C)Interpretation for aq_577Follow-up Actions
>+5Strong stabilizing effectOptimize condition for structural studies, investigate mechanism of stabilization
+2 to +5Moderate stabilizationConsider for buffer optimization, potential ligand or cofactor
-2 to +2No significant effectLikely not physiologically relevant
-2 to -5Moderate destabilizationPossible specific binding causing conformational change
<-5Strong destabilizing effectPotential denaturant or condition to avoid, possible unfolding mechanism

When screening ligands, use hierarchical clustering to identify chemical scaffolds that impart similar stability effects, potentially indicating similar binding modes. For physiologically relevant interpretations, compare thermal stability profiles with enzymatic activity measurements under the same conditions to correlate structural stability with functional properties.

What statistical approaches are appropriate for analyzing enzymatic activity data for aq_577?

When analyzing enzymatic activity data for aq_577, appropriate statistical approaches must account for the unique characteristics of thermophilic enzymes. Begin with standard Michaelis-Menten kinetic analysis to determine KM, kcat, and catalytic efficiency (kcat/KM) across multiple temperatures (60°C, 75°C, 90°C) . For comparing activity under different conditions, use two-way ANOVA with temperature and substrate concentration as factors, followed by Tukey's post-hoc test to identify significant differences. When analyzing temperature-dependent kinetics, apply the Arrhenius equation to calculate activation energy, and use linear regression of ln(k) versus 1/T plots to identify potential breaks or non-linearity that might indicate temperature-dependent conformational changes. For inhibition studies, use mixed-model analysis to accommodate nested data structures when testing multiple inhibitors at various concentrations. To ensure reproducibility, perform at least three independent experiments with technical triplicates, report both biological and technical variation, and calculate 95% confidence intervals for all kinetic parameters. When comparing aq_577 to related enzymes, use multivariate analysis such as principal component analysis (PCA) to identify patterns in kinetic parameters across different conditions.

How can circular dichroism spectroscopy data be used to analyze the secondary structure composition of aq_577?

Circular dichroism (CD) spectroscopy provides valuable insights into the secondary structure composition of aq_577, especially when monitoring temperature-dependent structural changes. When collecting CD data, scan the far-UV spectrum (190-260 nm) at various temperatures (25°C, 60°C, 85°C, 95°C) using a thermostated cuvette holder with constant nitrogen purging to minimize signal noise at lower wavelengths . For data analysis, apply multiple algorithm approaches using software packages like CDNN, SELCON3, CDSSTR, and CONTIN/LL to deconvolute spectra into secondary structure elements (α-helix, β-sheet, turns, random coil). Compare the results from different algorithms to obtain consensus values with standard deviations. When interpreting CD spectra of aq_577, note that thermophilic proteins often exhibit higher α-helical content and more compact structures than their mesophilic counterparts. To quantify thermal stability, monitor the CD signal at 222 nm (α-helix) or 218 nm (β-sheet) during thermal denaturation from 25°C to 110°C with a heating rate of 1°C/min. Fit the resulting thermal denaturation curve to a two-state model to determine the melting temperature (Tm) and the enthalpy change of unfolding (ΔH). For complete structural characterization, complement CD data with other spectroscopic techniques such as fluorescence and infrared spectroscopy.

How can aq_577 be utilized in biotechnological applications requiring thermostable proteins?

Recombinant Aquifex aeolicus Uncharacterized protein aq_577 offers significant potential for biotechnological applications due to its thermostability derived from the hyperthermophilic bacterium growing at temperatures of 85-95°C. Once the enzymatic function is characterized, aq_577 can be engineered as a biocatalyst for high-temperature industrial processes, particularly where conventional enzymes denature . For biocatalytic applications, immobilize aq_577 on thermostable supports such as ceramic materials or functionalized magnetic nanoparticles to enable repeated use and simplified product recovery. Protein engineering through site-directed mutagenesis can further enhance thermostability or alter substrate specificity for specific applications. Beyond enzymatic applications, the inherent thermostability of aq_577 makes it an excellent scaffold for designing thermostable biosensors capable of operating under harsh conditions. For structural biology research, aq_577 can serve as a model system for understanding principles of protein thermostability, potentially informing the design of other thermostable proteins through comparative analysis of structure-stability relationships.

What approaches can be used to study the evolutionary relationships between aq_577 and related proteins across thermophilic and mesophilic organisms?

Studying the evolutionary relationships of aq_577 requires a comprehensive phylogenetic analysis incorporating sequence, structural, and functional data. Begin with position-specific iterative BLAST (PSI-BLAST) searches to identify remote homologs across diverse organisms, followed by multiple sequence alignment using MAFFT or T-Coffee algorithms optimized for distantly related sequences . Construct maximum-likelihood phylogenetic trees using RAxML or IQ-TREE with appropriate substitution models (typically LG+G+F for proteins), and assess node support through ultrafast bootstrap approximation (1000 replicates). To understand selective pressures, calculate the ratio of non-synonymous to synonymous substitutions (dN/dS) across branches using PAML, identifying sites under positive or purifying selection. Complement sequence-based analyses with structural comparisons using tools like DALI or TM-align to identify structural conservation patterns that might not be apparent from sequence alone. Ancestral sequence reconstruction can provide insights into the evolutionary trajectory of thermostability by inferring and experimentally characterizing ancestral forms of the protein. Finally, use comparative genomics to analyze gene neighborhood conservation and horizontal gene transfer events that might have influenced the evolution of aq_577 and its homologs across thermophilic and mesophilic lineages.

What protein engineering strategies could enhance the stability or modify the function of aq_577 for research applications?

Engineering aq_577 for enhanced stability or modified function requires strategic approaches tailored to its thermophilic nature. Begin with computational design using Rosetta or FoldX to identify stabilizing mutations through energy calculations, focusing on surface charge optimization, disulfide bond introduction, and hydrophobic core packing . For functional modifications, implement rational design based on structural models, targeting active site residues identified through homology or conservation analysis. Directed evolution approaches should employ specialized high-temperature selection systems, such as thermoduric E. coli strains or in vitro compartmentalization techniques that maintain selection pressure at elevated temperatures. When designing libraries, use site-saturation mutagenesis at positions predicted to influence substrate binding or catalysis, followed by high-throughput screening using fluorescent or colorimetric assays adapted for thermostable enzymes. Domain swapping with functionally characterized homologs offers another approach for introducing new functionalities while maintaining thermostability. For all engineering efforts, implement iterative cycles of design-build-test-learn, utilizing deep mutational scanning and machine learning to identify non-obvious sequence-function relationships that can guide subsequent engineering rounds.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.